PPIRE00023
Target Protein Information
| Protein_Name | Substance-K receptor |
|---|---|
| Protein_Sequence | MGTCDIVTEANISSGPESNTTGITAFSMPSWQLALWATAYLALVLVAVTGNAIVIWIILAHRRMRTVTNYFIVNLALADLCMAAFNAAFNFVYASHNIWYFGRAFCYFQNLFPITAMFVSIYSMTAIAADRYMAIVHPFQPRLSAPSTKAVIAGIWLVALALASPQCFYSTVTMDQGATKCVVAWPEDSGGKTLLLYHLVVIALIYFLPLAVMFVAYSVIGLTLWRRAVPGHQAHGANLRHLQAMKKFVKTMVLVVLTFAICWLPYHLYFILGSFQEDIYCHKFIQQVYLALFWLAMSSTMYNPIIYCCLNHRFRSGFRLAFRCCPWVTPTKEDKLELTPTTSLSTRVNRCHTKETLFMAGDTAPSEATSGEAGRPQDGSGLWFGYGLLAPTKTHVEI |
| Organism_Source | Homo sapiens |
| Functional_Classification | G protein-coupled receptor |
| Cellular_Localization | Plasma membrane |
| Gene_Names | TACR2 |
| UniProt_ID | P21452 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Physalaemin |
|---|---|
| Peptide_Sequence | AGQHSKDNMFGLM |
| Peptide_Length | 13 |
| Peptide_SMILES | CSCC[C@H](NC(=O)[C@H](CC(C)C)NC(=O)CNC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CCSC)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@H](CCC(N)=O)NC(=O)CNC(=O)[C@H](C)N)C(=O)O |
| Chemical_Modification | |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1435.64 |
|---|---|
| Aliphatic_Index | 37.69231 |
| Aromaticity | 0.07692 |
| Average_Rotatable_Bonds | 3.76923 |
| Charge_at_pH_7 | 0.08904 |
| Isoelectric_Point | 7.54935 |
|---|---|
| Hydrogen_Bond_Acceptors | 22 |
| Hydrogen_Bond_Donors | 20 |
| Topological_Polar_Surface_Area | 610.93000 |
| X_logP_energy | -7.00370 |
Interaction Information
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Agonist and antagonist binding to tachykinin peptide NK-2 receptors. |
| Release_Year | 1988 |
| PMID | 2838713 |
| DOI | 10.1016/0024-3205(88)90246-9 |