PPIRE00031
Target Protein Information
| Protein_Name | Substance-K receptor |
|---|---|
| Protein_Sequence | MGTCDIVTEANISSGPESNTTGITAFSMPSWQLALWATAYLALVLVAVTGNAIVIWIILAHRRMRTVTNYFIVNLALADLCMAAFNAAFNFVYASHNIWYFGRAFCYFQNLFPITAMFVSIYSMTAIAADRYMAIVHPFQPRLSAPSTKAVIAGIWLVALALASPQCFYSTVTMDQGATKCVVAWPEDSGGKTLLLYHLVVIALIYFLPLAVMFVAYSVIGLTLWRRAVPGHQAHGANLRHLQAMKKFVKTMVLVVLTFAICWLPYHLYFILGSFQEDIYCHKFIQQVYLALFWLAMSSTMYNPIIYCCLNHRFRSGFRLAFRCCPWVTPTKEDKLELTPTTSLSTRVNRCHTKETLFMAGDTAPSEATSGEAGRPQDGSGLWFGYGLLAPTKTHVEI |
| Organism_Source | Homo sapiens |
| Functional_Classification | G protein-coupled receptor |
| Cellular_Localization | Plasma membrane |
| Gene_Names | TACR2 |
| UniProt_ID | P21452 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | SP(4-11) |
|---|---|
| Peptide_Sequence | PQQFFGLM |
| Peptide_Length | 8 |
| Peptide_SMILES | CSCC[C@H](NC(=O)[C@H](CC(C)C)NC(=O)CNC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H]1CCCN1)C(=O)O |
| Chemical_Modification | |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 967.15 |
|---|---|
| Aliphatic_Index | 48.75000 |
| Aromaticity | 0.25000 |
| Average_Rotatable_Bonds | 3.75000 |
| Charge_at_pH_7 | -0.00202 |
| Isoelectric_Point | 6.10000 |
|---|---|
| Hydrogen_Bond_Acceptors | 12 |
| Hydrogen_Bond_Donors | 11 |
| Topological_Polar_Surface_Area | 339.21000 |
| X_logP_energy | -1.33640 |
Interaction Information
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Agonist and antagonist binding to tachykinin peptide NK-2 receptors. |
| Release_Year | 1988 |
| PMID | 2838713 |
| DOI | 10.1016/0024-3205(88)90246-9 |