PPIRE00197
Target Protein Information
| Protein_Name | Melanocortin receptor 3 |
|---|---|
| Protein_Sequence | MNASCCLPSVQPTLPNGSEHLQAPFFSNQSSSAFCEQVFIKPEVFLSLGIVSLLENILVILAVVRNGNLHSPMYFFLCSLAVADMLVSVSNALETIMIAIVHSDYLTFEDQFIQHMDNIFDSMICISLVASICNLLAIAVDRYVTIFYALRYHSIMTVRKALTLIVAIWVCCGVCGVVFIVYSESKMVIVCLITMFFAMMLLMGTLYVHMFLFARLHVKRIAALPPADGVAPQQHSCMKGAVTITILLGVFIFCWAPFFLHLVLIITCPTNPYCICYTAHFNTYLVLIMCNSVIDPLIYAFRSLELRNTFREILCGCNGMNLG |
| Organism_Source | Homo sapiens |
| Functional_Classification | G protein-coupled receptor |
| Cellular_Localization | Plasma membrane |
| Gene_Names | MC3R |
| UniProt_ID | P41968 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Ac-Oic6-D-4,4'Bip7-Pip8-Trp9-Gly10-NH2 |
|---|---|
| Peptide_Sequence | XXXWG |
| Peptide_Length | 5 |
| Peptide_SMILES | NCC(=O)NCC(=O)NCC(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)NCC(=O)O |
| Chemical_Modification | X1=Octahydroindole-2-carboxylic acid, X2=D-4,4'-Biphenylalanine, X3=Pipecolic acid |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 432.44 |
|---|---|
| Aliphatic_Index | 0.00000 |
| Aromaticity | 0.20000 |
| Average_Rotatable_Bonds | 2.20000 |
| Charge_at_pH_7 | -0.00202 |
| Isoelectric_Point | 6.10000 |
|---|---|
| Hydrogen_Bond_Acceptors | 6 |
| Hydrogen_Bond_Donors | 7 |
| Topological_Polar_Surface_Area | 195.51000 |
| X_logP_energy | -2.41290 |
Interaction Information
| Affinity | IC50=9120 nM |
|---|---|
| Affinity_Assay | Ligand competition binding assay |
| PDB_ID | None |
| Type | Agonist |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Potent and selective agonists of alpha-melanotropin (alphaMSH)action at human melanocortin receptor 5; linear analogs of alpha-melanotropin. |
| Release_Year | 2007 |
| PMID | 17376561 |
| DOI | 10.1016/j.peptides.2007.02.011 |