PPIRE00256
Target Protein Information
| Protein_Name | Melanocortin receptor 3 |
|---|---|
| Protein_Sequence | MNASCCLPSVQPTLPNGSEHLQAPFFSNQSSSAFCEQVFIKPEVFLSLGIVSLLENILVILAVVRNGNLHSPMYFFLCSLAVADMLVSVSNALETIMIAIVHSDYLTFEDQFIQHMDNIFDSMICISLVASICNLLAIAVDRYVTIFYALRYHSIMTVRKALTLIVAIWVCCGVCGVVFIVYSESKMVIVCLITMFFAMMLLMGTLYVHMFLFARLHVKRIAALPPADGVAPQQHSCMKGAVTITILLGVFIFCWAPFFLHLVLIITCPTNPYCICYTAHFNTYLVLIMCNSVIDPLIYAFRSLELRNTFREILCGCNGMNLG |
| Organism_Source | Homo sapiens |
| Functional_Classification | G protein-coupled receptor |
| Cellular_Localization | Plasma membrane |
| Gene_Names | MC3R |
| UniProt_ID | P41968 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Peptide 7 |
|---|---|
| Peptide_Sequence | XDHXXWK |
| Peptide_Length | 7 |
| Peptide_SMILES | NCCCC[C@H](NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)CNC(=O)CNC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@H](CC(=O)O)NC(=O)CN)C(=O)O |
| Chemical_Modification | X1=Norleucine, X4=D-2'-Naphthylalanine, X5=Nipecotic acid |
| Cyclization_Method | D2<>K7; Main chain cyclization; Amide bond |
| Linear/Cyclic | Cyclic |
| N-terminal_Modification | Acetyl |
| C-terminal_Modification | Amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 755.79 |
|---|---|
| Aliphatic_Index | 0.00000 |
| Aromaticity | 0.14286 |
| Average_Rotatable_Bonds | 3.28571 |
| Charge_at_pH_7 | 0.08904 |
| Isoelectric_Point | 7.54935 |
|---|---|
| Hydrogen_Bond_Acceptors | 11 |
| Hydrogen_Bond_Donors | 12 |
| Topological_Polar_Surface_Area | 345.71000 |
| X_logP_energy | -3.50520 |
Interaction Information
| Affinity | IC50=0.73 uM |
|---|---|
| Affinity_Assay | Ligand competition binding assay |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Potent and selective peptide agonists of alpha-melanocyte stimulating hormone (alphaMSH)action at human melanocortin receptor 5; their synthesis and biological evaluation in vitro. |
| Release_Year | 2007 |
| PMID | 17539827 |
| DOI | 10.1111/j.1747-0285.2007.00513.x |