PPIRE00332
Target Protein Information
| Protein_Name | High affinity immunoglobulin epsilon receptor subunit gamma |
|---|---|
| Protein_Sequence | MIPAVILFLLLLVEEAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKADIASREKSDAVYTGLNTRNQETYETLKHEKPPQ |
| Organism_Source | Rattus norvegicus |
| Functional_Classification | Receptor |
| Cellular_Localization | Plasma membrane |
| Gene_Names | Fcer1g |
| UniProt_ID | P20411 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | MCD Peptide |
|---|---|
| Peptide_Sequence | IKCNCKRHVIKPHICKRICKGKN |
| Peptide_Length | 23 |
| Peptide_SMILES | CC[C@H](C)[C@H](N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CS)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@@H](CCCCN)C(=O)N1CCC[C@H]1C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@H](C(=O)N[C@@H](CS)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@H](C(=O)N[C@@H](CS)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)O)[C@@H](C)CC)[C@@H](C)CC)[C@@H](C)CC)C(C)C |
| Chemical_Modification | None |
| Cyclization_Method | C3<->C15; C5<->C19; Side chain cyclization; Disulfide bond |
| Linear/Cyclic | Cyclic |
| N-terminal_Modification | Free |
| C-terminal_Modification | Amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2720.42 |
|---|---|
| Aliphatic_Index | 80.43478 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 4.21739 |
| Charge_at_pH_7 | 7.93013 |
| Isoelectric_Point | 10.79644 |
|---|---|
| Hydrogen_Bond_Acceptors | 40 |
| Hydrogen_Bond_Donors | 43 |
| Topological_Polar_Surface_Area | 1118.19000 |
| X_logP_energy | -10.25596 |
Interaction Information
| Affinity | IC50=3200 nM |
|---|---|
| Affinity_Assay | Fluorescence Polarization |
| PDB_ID | None |
| Type | Agonist |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | [Ala12]MCD peptide: a lead peptide to inhibitors of immunoglobulin E binding to mast cell receptors. |
| Release_Year | 2008 |
| PMID | 16083440 |
| DOI | 10.1111/j.1399-3011.2005.00281.x |