PPIRE00374
Target Protein Information
| Protein_Name | SPRY domain-containing SOCS box protein 1 |
|---|---|
| Protein_Sequence | MGQKVTGGIKTVDMRDPTYRPLKQELQGLDYCKPTRLDLLLDMPPVSYDVQLLHSWNNNDRSLNVFVKEDDKLIFHRHPVAQSTDAIRGKVGYTRGLHVWQITWAMRQRGTHAVVGVATADAPLHSVGYTTLVGNNHESWGWDLGRNRLYHDGKNQPSKTYPAFLEPDETFIVPDSFLVALDMDDGTLSFIVDGQYMGVAFRGLKGKKLYPVVSAVWGHCEIRMRYLNGLDPEPLPLMDLCRRSVRLALGRERLGEIHTLPLPASLKAYLLYQ |
| Organism_Source | Homo sapiens |
| Functional_Classification | E3 ubiquitin ligase adaptors |
| Cellular_Localization | Cytoplasm |
| Gene_Names | SPSB1 |
| UniProt_ID | Q96BD6 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | VASA |
|---|---|
| Peptide_Sequence | DINNNNNIVEDVERKREFYI |
| Peptide_Length | 20 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@@H](NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H](NC(=O)[C@@H](N)CC(=O)O)[C@@H](C)CC)[C@@H](C)CC)C(C)C)C(C)C)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2494.70 |
|---|---|
| Aliphatic_Index | 87.50000 |
| Aromaticity | 0.10000 |
| Average_Rotatable_Bonds | 4.30000 |
| Charge_at_pH_7 | -1.99695 |
| Isoelectric_Point | 4.26469 |
|---|---|
| Hydrogen_Bond_Acceptors | 35 |
| Hydrogen_Bond_Donors | 39 |
| Topological_Polar_Surface_Area | 1188.22000 |
| X_logP_energy | -12.17286 |
Interaction Information
| Affinity | KD=73 nM |
|---|---|
| Affinity_Assay | Isothermal titration calorimetry |
| PDB_ID | 3F2O |
| Type | Agonist |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Structural basis for Par-4 recognition by the SPRY domain- and SOCS box-containing proteins SPSB1, SPSB2, and SPSB4. |
| Release_Year | 2010 |
| PMID | 20561531 |
| DOI | 10.1016/j.jmb.2010.06.017 |