PPIRE00742
Target Protein Information
| Protein_Name | Delta-type opioid receptor |
|---|---|
| Protein_Sequence | MEPVPSARAELQFSLLANVSDTFPSAFPSASANASGSPGARSASSLALAIAITALYSAVCAVGLLGNVLVMFGIVRYTKLKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELLCKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVGVPIMVMAVTQPRDGAVVCTLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRLRSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDINRRDPLVVAALHLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRAPCGGQEPGSLRRPRQATARERVTACTPSDGPGGGAAA |
| Organism_Source | Rattus norvegicus |
| Functional_Classification | G protein-coupled receptor |
| Cellular_Localization | plasma membrane |
| Gene_Names | Oprd1 |
| UniProt_ID | P33533 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | [(2R,3R)-b-iPrPhe3]DELT I |
|---|---|
| Peptide_Sequence | YaXDVVG |
| Peptide_Length | 7 |
| Peptide_SMILES | CC(C)[C@H](NC(=O)[C@H](CC(=O)O)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@@H](N)Cc1ccc(O)cc1)C(=O)N[C@H](C(=O)NCC(=O)O)C(C)C |
| Chemical_Modification | X3=b-isopropylphenylalanine |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 679.73 |
|---|---|
| Aliphatic_Index | 97.14286 |
| Aromaticity | 0.14286 |
| Average_Rotatable_Bonds | 2.71429 |
| Charge_at_pH_7 | -1.00242 |
| Isoelectric_Point | 3.74999 |
|---|---|
| Hydrogen_Bond_Acceptors | 10 |
| Hydrogen_Bond_Donors | 10 |
| Topological_Polar_Surface_Area | 295.45000 |
| X_logP_energy | -2.67520 |
Interaction Information
| Affinity | IC50=343 nM |
|---|---|
| Affinity_Assay | mouse vas deferens bioassay |
| PDB_ID | None |
| Type | Agonist |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Synthesis, biology, NMR and conformation studies of the topographically constrained delta-opioid selective peptide analogs of [beta-iPrPhe(3)]deltorphin I. |
| Release_Year | 2001 |
| PMID | 11328484 |
| DOI | 10.1046/j.1397-002x.2000.00000.x |