PPIRE00752
Target Protein Information
| Protein_Name | Serine protease 1 |
|---|---|
| Protein_Sequence | MNPLLILTFVAAALAAPFDDDDKIVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVSAGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVINARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKITSNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIKNTIAANS |
| Organism_Source | Homo sapiens |
| Functional_Classification | serine proteases |
| Cellular_Localization | extracellular |
| Gene_Names | PRSS1 |
| UniProt_ID | P07477 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | PepTry |
|---|---|
| Peptide_Sequence | CTKSIPPQC |
| Peptide_Length | 9 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CO)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](NC(=O)[C@@H](N)CS)[C@@H](C)O)C(=O)N1CCC[C@H]1C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CS)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | side chain-side chain cyclization; C1<->C9; disulfide bond |
| Linear/Cyclic | Cyclic |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 976.17 |
|---|---|
| Aliphatic_Index | 43.33333 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 3.11111 |
| Charge_at_pH_7 | 0.87374 |
| Isoelectric_Point | 8.22969 |
|---|---|
| Hydrogen_Bond_Acceptors | 16 |
| Hydrogen_Bond_Donors | 14 |
| Topological_Polar_Surface_Area | 388.11000 |
| X_logP_energy | -5.03760 |
Interaction Information
| Affinity | Ki=119 nM |
|---|---|
| Affinity_Assay | Enzyme Inhibition Kinetics |
| PDB_ID | 6EAT |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Blood pressure-lowering effects of a Bowman-Birk inhibitor and its derived peptides in normotensive and hypertensive rats. |
| Release_Year | 2020 |
| PMID | 32669617 |
| DOI | 10.1038/s41598-020-66624-3 |