PPIRE00833
Target Protein Information
| Protein_Name | Melanin-concentrating hormone receptor 1 |
|---|---|
| Protein_Sequence | MDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT |
| Organism_Source | Homo sapiens |
| Functional_Classification | G protein-coupled receptor |
| Cellular_Localization | plasma membrane |
| Gene_Names | MCHR1 |
| UniProt_ID | Q99705 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Ac-Arg6-cyclo(S-S)(Cys7-Met8-Ava9 |
|---|---|
| Peptide_Sequence | RCMXRVYXC |
| Peptide_Length | 9 |
| Peptide_SMILES | CSCC[C@H](NC(=O)[C@H](CS)NC(=O)[C@@H](N)CCCNC(=N)N)C(=O)NCC(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@H](C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)NCC(=O)N[C@@H](CS)C(=O)O)C(C)C |
| Chemical_Modification | X4=5-aminovaleric acid; X9=5-aminovaleric acid |
| Cyclization_Method | Side chain-side chain cyclization; C2<->C10; disulfide bond |
| Linear/Cyclic | Cyclic |
| N-terminal_Modification | Acetyl |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1044.27 |
|---|---|
| Aliphatic_Index | 32.22222 |
| Aromaticity | 0.11111 |
| Average_Rotatable_Bonds | 3.66667 |
| Charge_at_pH_7 | 1.87318 |
| Isoelectric_Point | 8.80386 |
|---|---|
| Hydrogen_Bond_Acceptors | 16 |
| Hydrogen_Bond_Donors | 19 |
| Topological_Polar_Surface_Area | 440.15000 |
| X_logP_energy | -4.71696 |
Interaction Information
| Affinity | KD=3.6 nM |
|---|---|
| Affinity_Assay | 1H NMR spectroscopy |
| PDB_ID | None |
| Type | antagonist |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Synthesis and biological evaluation in vitro of selective, high affinity peptide antagonists of human melanin-concentrating hormone action at human melanin-concentrating hormone receptor 1. |
| Release_Year | 2002 |
| PMID | 12009900 |
| DOI | 10.1021/bi0200514 |