PPIRE00887
Target Protein Information
| Protein_Name | Pepsin A |
|---|---|
| Protein_Sequence | MKWLLLLSLVVLSECLVKVPLVRKKSLRQNLIKNGKLKDFLKTHKHNPASKYFPEAAALIGDEPLENYLDTEYFGTIGIGTPAQDFTVIFDTGSSNLWVPSVYCSSLACSDHNQFNPDDSSTFEATSQELSITYGTGSMTGILGYDTVQVGGISDTNQIFGLSETEPGSFLYYAPFDGILGLAYPSISASGATPVFDNLWDQGLVSQDLFSVYLSSNDDSGSVVLLGGIDSSYYTGSLNWVPVSVEGYWQITLDSITMDGETIACSGGCQAIVDTGTSLLTGPTSAIANIQSDIGASENSDGEMVISCSSIDSLPDIVFTINGVQYPLSPSAYILQDDDSCTSGFEGMDVPTSSGELWILGDVFIRQYYTVFDRANNKVGLAPVA |
| Organism_Source | Sus scrofa |
| Functional_Classification | aspartyl proteases |
| Cellular_Localization | extracellular |
| Gene_Names | PGA |
| UniProt_ID | P00791 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Pepsta(h) |
|---|---|
| Peptide_Sequence | VVX |
| Peptide_Length | 3 |
| Peptide_SMILES | CC(C)[C@H](N)C(=O)N[C@H](C(=O)NCC(=O)O)C(C)C |
| Chemical_Modification | X3=4-amino-3-hydroxy-6-methylheptanoic acid |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | hexyl |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 273.33 |
|---|---|
| Aliphatic_Index | 193.33333 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 2.33333 |
| Charge_at_pH_7 | -0.00202 |
| Isoelectric_Point | 6.10000 |
|---|---|
| Hydrogen_Bond_Acceptors | 4 |
| Hydrogen_Bond_Donors | 4 |
| Topological_Polar_Surface_Area | 121.52000 |
| X_logP_energy | -0.68870 |
Interaction Information
| Affinity | KD=172.4 nM |
|---|---|
| Affinity_Assay | Surface plasmon resonance |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Binding of beta-secretase to a peptide inhibitor-carrying SAM. |
| Release_Year | 2010 |
| PMID | 20338731 |
| DOI | 10.1016/j.colsurfb.2010.02.022 |