PPIRE01192
Target Protein Information
| Protein_Name | F-box only protein 31 |
|---|---|
| Protein_Sequence | MAVCARLCGVGPSRGCRRRQQRRGPAETAAADSEPDTDPEEERIEASAGVGGGLCAGPSPPPPRCSLLELPPELLVEIFASLPGTDLPSLAQVCTKFRRILHTDTIWRRRCREEYGVCENLRKLEITGVSCRDVYAKLLHRYRHILGLWQPDIGPYGGLLNVVVDGLFIIGWMYLPPHDPHVDDPMRFKPLFRIHLMERKAATVECMYGHKGPHHGHIQIVKKDEFSTKCNQTDHHRMSGGRQEEFRTWLREEWGRTLEDIFHEHMQELILMKFIYTSQYDNCLTYRRIYLPPSRPDDLIKPGLFKGTYGSHGLEIVMLSFHGRRARGTKITGDPNIPAGQQTVEIDLRHRIQLPDLENQRNFNELSRIVLEVRERVRQEQQEGGHEAGEGRGRQGPRESQPSPAQPRAEAPSKGPDGTPGEDGGEPGDAVAAAEQPAQCGQGQPFVLPVGVSSRNEDYPRTCRMCFYGTGLIAGHGFTSPERTPGVFILFDEDRFGFVWLELKSFSLYSRVQATFRNADAPSPQAFDEMLKNIQSLTS |
| Organism_Source | Homo sapiens |
| Functional_Classification | ubiquitin-protein ligases |
| Cellular_Localization | Nucleus |
| Gene_Names | FBXO31 |
| UniProt_ID | Q5XUX0 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Cyclin D3 C-terminal peptide(residues 276-292unphosphorylated) |
|---|---|
| Peptide_Sequence | QLGSKVDYFTSPSDVDI |
| Peptide_Length | 17 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CC(=O)O)NC(=O)[C@@H](NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CO)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CC(=O)O)NC(=O)[C@@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CCC(N)=O)C(C)C)[C@@H](C)O)C(C)C)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1871.03 |
|---|---|
| Aliphatic_Index | 80.00000 |
| Aromaticity | 0.11765 |
| Average_Rotatable_Bonds | 3.47059 |
| Charge_at_pH_7 | -2.00182 |
| Isoelectric_Point | 3.82610 |
|---|---|
| Hydrogen_Bond_Acceptors | 28 |
| Hydrogen_Bond_Donors | 27 |
| Topological_Polar_Surface_Area | 802.29000 |
| X_logP_energy | -8.93580 |
Interaction Information
| Affinity | KD=1.9 uM |
|---|---|
| Affinity_Assay | Isothermal titration calorimetry |
| PDB_ID | 5VZT |
| Type | substrate |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Structural basis of the phosphorylation-independent recognition of cyclin D1 by the SCFFBXO31 ubiquitin ligase. |
| Release_Year | 2017 |
| PMID | 29279382 |
| DOI | 10.1073/pnas.1708677115 |