PPIRE01243
Target Protein Information
| Protein_Name | Chromobox protein homolog 7 |
|---|---|
| Protein_Sequence | MELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEERDRASGYRKRGPKPKRLLLQRLYSMDLRSSHKAKGKEKLCFSLTCPLGSGSPEGVVKAGAPELVDKGPLVPTLPFPLRKPRKAHKYLRLSRKKFPPRGPNLESHSHRRELFLQEPPAPDVLQAAGEWEPAAQPPEEEADADLAEGPPPWTPALPSSEVTVTDITANSITVTFREAQAAEGFFRDRSGKF |
| Organism_Source | Homo sapiens |
| Functional_Classification | chromodomains |
| Cellular_Localization | nucleus |
| Gene_Names | CBX7 |
| UniProt_ID | O95931 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | UNC3567 |
|---|---|
| Peptide_Sequence | GLFAXSTHG |
| Peptide_Length | 9 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)CN)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](C)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@H](C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)NCC(=O)O)[C@@H](C)O |
| Chemical_Modification | X5=N,N-diethyllysine |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Benzoylation |
| C-terminal_Modification | methyl ester |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 845.91 |
|---|---|
| Aliphatic_Index | 54.44444 |
| Aromaticity | 0.11111 |
| Average_Rotatable_Bonds | 2.77778 |
| Charge_at_pH_7 | 0.08889 |
| Isoelectric_Point | 7.55032 |
|---|---|
| Hydrogen_Bond_Acceptors | 13 |
| Hydrogen_Bond_Donors | 13 |
| Topological_Polar_Surface_Area | 365.26000 |
| X_logP_energy | -5.18150 |
Interaction Information
| Affinity | KD=6.7 uM |
|---|---|
| Affinity_Assay | Isothermal titration calorimetry |
| PDB_ID | None |
| Type | antagonist |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | A cellular chemical probe targeting the chromodomains of Polycomb repressive complex 1. |
| Release_Year | 2016 |
| PMID | 26807715 |
| DOI | 10.1038/nchembio.2007 |