PPIRE01318
Target Protein Information
| Protein_Name | Gamma-aminobutyric acid receptor-associated protein-like 1 |
|---|---|
| Protein_Sequence | MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK |
| Organism_Source | Homo sapiens |
| Functional_Classification | ubiquitin-like proteins |
| Cellular_Localization | Cytoplasm |
| Gene_Names | GABARAPL1 |
| UniProt_ID | Q9H0R8 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | NBR1-LIR_Y732W |
|---|---|
| Peptide_Sequence | SSEDWIIILE |
| Peptide_Length | 10 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CO)C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(=O)O)C(=O)O)[C@@H](C)CC)[C@@H](C)CC |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1204.34 |
|---|---|
| Aliphatic_Index | 156.00000 |
| Aromaticity | 0.10000 |
| Average_Rotatable_Bonds | 3.90000 |
| Charge_at_pH_7 | -2.99802 |
| Isoelectric_Point | 3.42471 |
|---|---|
| Hydrogen_Bond_Acceptors | 16 |
| Hydrogen_Bond_Donors | 17 |
| Topological_Polar_Surface_Area | 493.37000 |
| X_logP_energy | -2.14120 |
Interaction Information
| Affinity | KD=0.4 uM |
|---|---|
| Affinity_Assay | Isothermal titration calorimetry |
| PDB_ID | 2L8J |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Characterization of the interaction of GABARAPL-1 with the LIR motif of NBR1. |
| Release_Year | 2011 |
| PMID | 21620860 |
| DOI | 10.1016/j.jmb.2011.05.003 |