PPIRE01391
Target Protein Information
| Protein_Name | Gem-associated protein 2 |
|---|---|
| Protein_Sequence | MRRAELAGLKTMAWVPAESAVEELMPRLLPVEPCDLTEGFDPSVPPRTPQEYLRRVQIEAAQCPDVVVAQIDPKKLKRKQSVNISLSGCQPAPEGYSPTLQWQQQQVAQFSTVRQNVNKHRSHWKSQQLDSNVTMPKSEDEEGWKKFCLGEKLCADGAVGPATNESPGIDYVQIGFPPLLSIVSRMNQATVTSVLEYLSNWFGERDFTPELGRWLYALLACLEKPLLPEAHSLIRQLARRCSEVRLLVDSKDDERVPALNLLICLVSRYFDQRDLADEPS |
| Organism_Source | Homo sapiens |
| Functional_Classification | scaffolding proteins |
| Cellular_Localization | Cytoplasm |
| Gene_Names | GEMIN2 |
| UniProt_ID | O14893 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | SMN26-51_A46N |
|---|---|
| Peptide_Sequence | MADIAGGELPSLEDLEKDLKEQEELG |
| Peptide_Length | 26 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CCSC)C(=O)N[C@@H](C)C(=O)NCC(=O)NCC(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CC(C)C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2830.11 |
|---|---|
| Aliphatic_Index | 97.69231 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 3.88462 |
| Charge_at_pH_7 | -6.99062 |
| Isoelectric_Point | 3.61221 |
|---|---|
| Hydrogen_Bond_Acceptors | 41 |
| Hydrogen_Bond_Donors | 39 |
| Topological_Polar_Surface_Area | 1233.09000 |
| X_logP_energy | -10.88310 |
Interaction Information
| Affinity | KD=42 nM |
|---|---|
| Affinity_Assay | Fluorescence Polarization |
| PDB_ID | 2LEH |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Solution structure of the core SMN-Gemin2 complex. |
| Release_Year | 2012 |
| PMID | 22607171 |
| DOI | 10.1042/BJ20120241 |