PPIRE01659
Target Protein Information
| Protein_Name | 14-3-3 protein epsilon |
|---|---|
| Protein_Sequence | MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ |
| Organism_Source | Homo sapiens |
| Functional_Classification | E3 ubiquitin ligase adaptors |
| Cellular_Localization | Cytoplasm |
| Gene_Names | YWHAE |
| UniProt_ID | P62258 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | [Tyr176]pS(174-182) |
|---|---|
| Peptide_Sequence | QRYNXAPAR |
| Peptide_Length | 9 |
| Peptide_SMILES | C[C@H](NC(=O)[C@@H]1CCCN1C(=O)[C@H](C)NC(=O)CNC(=O)[C@H](CC(N)=O)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H](N)CCC(N)=O)C(=O)N[C@@H](CCCNC(=N)N)C(=O)O |
| Chemical_Modification | Y3=tyrosine; X5=phosphoserine |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Acetyl |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1032.13 |
|---|---|
| Aliphatic_Index | 22.22222 |
| Aromaticity | 0.11111 |
| Average_Rotatable_Bonds | 3.44444 |
| Charge_at_pH_7 | 1.99713 |
| Isoelectric_Point | 11.14762 |
|---|---|
| Hydrogen_Bond_Acceptors | 15 |
| Hydrogen_Bond_Donors | 18 |
| Topological_Polar_Surface_Area | 517.54000 |
| X_logP_energy | -6.93016 |
Interaction Information
| Affinity | KD=0.41 uM |
|---|---|
| Affinity_Assay | Surface plasmon resonance |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | The Development of CDC25A-Derived Phosphoseryl Peptides That Bind 14-3-3钄 with High Affinities. |
| Release_Year | 2024 |
| PMID | 38732131 |
| DOI | 10.3390/ijms25094918 |