PPIRE01766
Target Protein Information
| Protein_Name | CD81 antigen |
|---|---|
| Protein_Sequence | MGVEGCTKCIKYLLFVFNFVFWLAGGVILGVALWLRHDPQTTNLLYLELGDKPAPNTFYVGIYILIAVGAVMMFVGFLGCYGAIQESQCLLGTFFTCLVILFACEVAAGIWGFVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFEMILSMVLCCGIRNSSVY |
| Organism_Source | Homo sapiens |
| Functional_Classification | receptor |
| Cellular_Localization | Plasma membrane |
| Gene_Names | CD81 |
| UniProt_ID | P60033 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | P97 |
|---|---|
| Peptide_Sequence | ASRTYRLR |
| Peptide_Length | 8 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@@H](NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CO)NC(=O)[C@H](C)N)[C@@H](C)O)C(=O)N[C@@H](CCCNC(=N)N)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1022.18 |
|---|---|
| Aliphatic_Index | 61.25000 |
| Aromaticity | 0.12500 |
| Average_Rotatable_Bonds | 4.12500 |
| Charge_at_pH_7 | 2.99712 |
| Isoelectric_Point | 12.20421 |
|---|---|
| Hydrogen_Bond_Acceptors | 15 |
| Hydrogen_Bond_Donors | 21 |
| Topological_Polar_Surface_Area | 513.41000 |
| X_logP_energy | -6.03089 |
Interaction Information
| Affinity | KD=1.06 uM |
|---|---|
| Affinity_Assay | NMR chemical shift perturbation |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Screening of EWI-2-Derived Peptides for Targeting Tetraspanin CD81 and Their Effect on Cancer Cell Migration. |
| Release_Year | 2023 |
| PMID | 36979448 |
| DOI | 10.3390/biom13030510 |