PPIRE01788
Target Protein Information
| Protein_Name | CHRNA7-FAM7A fusion protein |
|---|---|
| Protein_Sequence | MQKYCIYQHFQFQLLIQHLWIAANCDIADERFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDLQMQEADISGYIPNGEWDLVGIPGKRSERFYECCKEPYPDVTFTVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMIIVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILLNWCAWFLRMKRPGEDKVRPACQHKQRRCSLASVEMSAVAPPPASNGNLLYIGFRGLDGVHCVPTPDSGVVCGRMACSPTHDEHLLHGGQPPEGDPDLAKILEEVRYIANRFRCQDESEAVCSEWKFAACVVDRLCLMAFSVFTIICTIGILMSAPNFVEAVSKDFA |
| Organism_Source | Homo sapiens |
| Functional_Classification | Receptor |
| Cellular_Localization | Plasma membrane |
| Gene_Names | CHRFAM7A |
| UniProt_ID | Q494W8 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | cycloR8 |
|---|---|
| Peptide_Sequence | CRRRRRRRRC |
| Peptide_Length | 10 |
| Peptide_SMILES | N=C(N)NCCC[C@H](NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H](N)CS)C(=O)N[C@@H](CS)C(=O)O |
| Chemical_Modification | |
| Cyclization_Method | C1<->C10, side chain cyclization, disulfide bond |
| Linear/Cyclic | Cyclic |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1473.79 |
|---|---|
| Aliphatic_Index | 0.00000 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 5.30000 |
| Charge_at_pH_7 | 7.87401 |
| Isoelectric_Point | 12.72189 |
|---|---|
| Hydrogen_Bond_Acceptors | 21 |
| Hydrogen_Bond_Donors | 37 |
| Topological_Polar_Surface_Area | 820.42000 |
| X_logP_energy | -11.27274 |
Interaction Information
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Inhibition of nicotinic acetylcholine receptors by oligoarginine peptides and polyamine-related compounds. |
| Release_Year | 2023 |
| PMID | 38169863 |
| DOI | 10.3389/fphar.2023.1327603 |