PPIRE02105
Target Protein Information
| Protein_Name | Melanocyte-stimulating hormone receptor |
|---|---|
| Protein_Sequence | MSTQEPQKSLLGSLNSNATSHLGLATNQSEPWCLYVSIPDGLFLSLGLVSLVENVLVVIAITKNRNLHSPMYYFICCLALSDLMVSVSIVLETTIILLLEAGILVARVALVQQLDNLIDVLICGSMVSSLCFLGIIAIDRYISIFYALRYHSIVTLPRARRAVVGIWMVSIVSSTLFITYYKHTAVLLCLVTFFLAMLALMAILYAHMFTRACQHAQGIAQLHKRRRSIRQGFCLKGAATLTILLGIFFLCWGPFFLHLLLIVLCPQHPTCSCIFKNFNLFLLLIVLSSTVDPLIYAFRSQELRMTLKEVLLCSW |
| Organism_Source | Mus musculus |
| Functional_Classification | receptor |
| Cellular_Localization | Plasma membrane |
| Gene_Names | Mc1r |
| UniProt_ID | Q01727 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | ALB-G1 |
|---|---|
| Peptide_Sequence | KGXDHfRWK |
| Peptide_Length | 9 |
| Peptide_SMILES | N=C(N)NCCC[C@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@H](CC(=O)O)NC(=O)CNC(=O)CNC(=O)[C@@H](N)CCCCN)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](CCCCN)C(=O)O |
| Chemical_Modification | X3=Norleucine; K1=4-p-(tolyl)butyric acid |
| Cyclization_Method | D4<->K9; side chain cyclization; amide bond |
| Linear/Cyclic | Cyclic |
| N-terminal_Modification | Other |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1130.27 |
|---|---|
| Aliphatic_Index | 0.00000 |
| Aromaticity | 0.22222 |
| Average_Rotatable_Bonds | 4.11111 |
| Charge_at_pH_7 | 2.08875 |
| Isoelectric_Point | 10.78905 |
|---|---|
| Hydrogen_Bond_Acceptors | 15 |
| Hydrogen_Bond_Donors | 18 |
| Topological_Polar_Surface_Area | 491.83000 |
| X_logP_energy | -3.53203 |
Interaction Information
| Affinity | IC50=0.67 nM |
|---|---|
| Affinity_Assay | NMR chemical shift perturbation |
| PDB_ID | None |
| Type | Agonist |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | The Effect of Albumin-Binding Moiety on Tumor Targeting and Biodistribution Properties of 67Ga-Labeled Albumin Binder-Conjugated Alpha-Melanocyte-Stimulating Hormone Peptides. |
| Release_Year | 2022 |
| PMID | 34762521 |
| DOI | 10.1089/cbr.2021.0273 |