PPIRE02133
Target Protein Information
| Protein_Name | Myc box-dependent-interacting protein 1 |
|---|---|
| Protein_Sequence | MAEMGSKGVTAGKIASNVQKKLTRAQEKVLQKLGKADETKDEQFEQCVQNFNKQLTEGTRLQKDLRTYLASVKAMHEASKKLNECLQEVYEPDWPGRDEANKIAENNDLLWMDYHQKLVDQALLTMDTYLGQFPDIKSRIAKRGRKLVDYDSARHHYESLQTAKKKDEAKIAKPVSLLEKAAPQWCQGKLQAHLVAQTNLLRNQAEEELIKAQKVFEEMNVDLQEELPSLWNSRVGFYVNTFQSIAGLEENFHKEMSKLNQNLNDVLVGLEKQHGSNTFTVKAQPSDNAPAKGNKSPSPPDGSPAATPEIRVNHEPEPAGGATPGATLPKSPSQLRKGPPVPPPPKHTPSKEVKQEQILSLFEDTFVPEISVTTPSQFEAPGPFSEQASLLDLDFDPLPPVTSPVKAPTPSGQSIPWDLWEPTESPAGSLPSGEPSAAEGTFAVSWPSQTAEPGPAQPAEASEVAGGTQPAAGAQEPGETAASEAASSSLPAVVVETFPATVNGTVEGGSGAGRLDLPPGFMFKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQDEGWLMGVKESDWNQHKELEKCRGVFPENFTERVP |
| Organism_Source | Homo sapiens |
| Functional_Classification | E3 ubiquitin ligase adaptors |
| Cellular_Localization | Cytoplasm |
| Gene_Names | BIN1 |
| UniProt_ID | O00499 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | CHIKV_R1739A_R1741S |
|---|---|
| Peptide_Sequence | STVPVAPPRRRAGSNLT |
| Peptide_Length | 17 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CO)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H]1CCCN1C(=O)[C@@H]1CCCN1C(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@@H]1CCCN1C(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](N)CO)[C@@H](C)O)C(C)C)C(C)C)C(=O)N[C@H](C(=O)O)[C@@H](C)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1779.03 |
|---|---|
| Aliphatic_Index | 68.82353 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 3.05882 |
| Charge_at_pH_7 | 2.99797 |
| Isoelectric_Point | 12.80107 |
|---|---|
| Hydrogen_Bond_Acceptors | 26 |
| Hydrogen_Bond_Donors | 29 |
| Topological_Polar_Surface_Area | 812.26000 |
| X_logP_energy | -11.88559 |
Interaction Information
| Affinity | KD=0.33 uM |
|---|---|
| Affinity_Assay | Isothermal titration calorimetry |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Structural Basis of the High Affinity Interaction between the Alphavirus Nonstructural Protein-3 (nsP3)and the SH3 Domain of Amphiphysin-2. |
| Release_Year | 2016 |
| PMID | 27268056 |
| DOI | 10.1074/jbc.M116.732412 |