PPIRE02169
Target Protein Information
| Protein_Name | Pol polyprotein |
|---|---|
| Protein_Sequence | AHLHALYLVHHEVWRPLAAAYQHQLDRPIVPHPFRLGDTVWVRRHQTNNLQPRWKAPYTVLLTTPTALKVDGIAAWIHAAHVKAATTPPAGTASGPTWKVQRSQNPLKIRLTRGAP |
| Organism_Source | Rauscher spleen focus-forming virus |
| Functional_Classification | Enzyme |
| Cellular_Localization | Nucleus |
| Gene_Names | pol |
| UniProt_ID | P03358 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | LEDGF-(365V-366) |
|---|---|
| Peptide_Sequence | VD |
| Peptide_Length | 2 |
| Peptide_SMILES | CC(C)[C@H](N)C(=O)N[C@@H](CC(=O)O)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 232.24 |
|---|---|
| Aliphatic_Index | 145.00000 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 3.00000 |
| Charge_at_pH_7 | -1.00157 |
| Isoelectric_Point | 3.74999 |
|---|---|
| Hydrogen_Bond_Acceptors | 4 |
| Hydrogen_Bond_Donors | 4 |
| Topological_Polar_Surface_Area | 129.72000 |
| X_logP_energy | -0.98620 |
Interaction Information
| Affinity | Ki=167181 nM |
|---|---|
| Affinity_Assay | Homogeneous time-resolved fluorescence resonance energy transfer |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Affinities between the binding partners of the HIV-1 integrase dimer-lens epithelium-derived growth factor (IN dimer-LEDGF)complex. |
| Release_Year | 2009 |
| PMID | 19801648 |
| DOI | 10.1074/jbc.M109.040121 |