PPIRE02291
Target Protein Information
| Protein_Name | Neutrophil elastase |
|---|---|
| Protein_Sequence | MTLGRRLACLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQLRGGHFCGATLIAPNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVILQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSLCRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQRSEDNPCPHPRDPDPASRTH |
| Organism_Source | Homo sapiens |
| Functional_Classification | Enzyme |
| Cellular_Localization | Extracellular |
| Gene_Names | ELANE |
| UniProt_ID | P08246 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Boc-glycyl-L-valyl-glycyl-alpha-azanorvaline benzyl ester |
|---|---|
| Peptide_Sequence | GVGX |
| Peptide_Length | 4 |
| Peptide_SMILES | CC(C)[C@H](NC(=O)CN)C(=O)NCC(=O)NCC(=O)O |
| Chemical_Modification | X4=alpha-azanorvaline |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Other |
| C-terminal_Modification | other |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 288.30 |
|---|---|
| Aliphatic_Index | 72.50000 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 2.00000 |
| Charge_at_pH_7 | -0.00202 |
| Isoelectric_Point | 6.10000 |
|---|---|
| Hydrogen_Bond_Acceptors | 5 |
| Hydrogen_Bond_Donors | 5 |
| Topological_Polar_Surface_Area | 150.62000 |
| X_logP_energy | -2.59710 |
Interaction Information
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Inhibitors of human leucocyte elastase. Peptides incorporating an Alpha-azanorvaline residue or a thiomethylene linkage in place of a peptide bond |
| Release_Year | 1987 |
| PMID | |
| DOI | 10.1039/P19870000111 |