PPIRE02301
Target Protein Information
| Protein_Name | Cytotoxic T-lymphocyte protein 4 |
|---|---|
| Protein_Sequence | MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN |
| Organism_Source | Homo sapiens |
| Functional_Classification | Immune-related protein |
| Cellular_Localization | Plasma membrane |
| Gene_Names | CTLA4 |
| UniProt_ID | P16410 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | peptide 16 |
|---|---|
| Peptide_Sequence | EIDTVLTPTGWVAKRYS |
| Peptide_Length | 17 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@@H](N)CCC(=O)O)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C(=O)N1CCC[C@H]1C(=O)N[C@H](C(=O)NCC(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@H](C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CO)C(=O)O)C(C)C)[C@@H](C)O)[C@@H](C)O)C(C)C)[C@@H](C)O |
| Chemical_Modification | None |
| Cyclization_Method | E1<->S17 main chain cyclization amide bond |
| Linear/Cyclic | Cyclic |
| N-terminal_Modification | Other |
| C-terminal_Modification | other |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1936.20 |
|---|---|
| Aliphatic_Index | 85.88235 |
| Aromaticity | 0.11765 |
| Average_Rotatable_Bonds | 3.47059 |
| Charge_at_pH_7 | -0.00094 |
| Isoelectric_Point | 6.48752 |
|---|---|
| Hydrogen_Bond_Acceptors | 27 |
| Hydrogen_Bond_Donors | 29 |
| Topological_Polar_Surface_Area | 799.59000 |
| X_logP_energy | -6.74443 |
Interaction Information
| Affinity | KD=31 uM |
|---|---|
| Affinity_Assay | Bio-Layer Interferometry |
| PDB_ID | None |
| Type | antagonist |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Computational design of a cyclic peptide that inhibits the CTLA4 immune checkpoint. |
| Release_Year | 2023 |
| PMID | 37122540 |
| DOI | 10.1039/d2md00409g |