PPIRE02326
Target Protein Information
| Protein_Name | Polyubiquitin-B |
|---|---|
| Protein_Sequence | MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGC |
| Organism_Source | Homo sapiens |
| Functional_Classification | other |
| Cellular_Localization | Cytoplasm |
| Gene_Names | UBB |
| UniProt_ID | P0CG47 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | RanBP2-NZF-L13T-V14F |
|---|---|
| Peptide_Sequence | KEGQWDCSACTFQNEGSSTKCAACQNPRK |
| Peptide_Length | 29 |
| Peptide_SMILES | C[C@H](NC(=O)[C@H](C)NC(=O)[C@H](CS)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)CNC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@@H](NC(=O)[C@H](CS)NC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CS)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](CCC(N)=O)NC(=O)CNC(=O)[C@H](CCC(=O)O)NC(=O)[C@@H](N)CCCCN)[C@@H](C)O)[C@@H](C)O)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCCCN)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 3178.49 |
|---|---|
| Aliphatic_Index | 10.34483 |
| Aromaticity | 0.06897 |
| Average_Rotatable_Bonds | 3.65517 |
| Charge_at_pH_7 | 0.75319 |
| Isoelectric_Point | 7.91495 |
|---|---|
| Hydrogen_Bond_Acceptors | 51 |
| Hydrogen_Bond_Donors | 53 |
| Topological_Polar_Surface_Area | 1453.58000 |
| X_logP_energy | -22.37233 |
Interaction Information
| Affinity | KD=976 uM |
|---|---|
| Affinity_Assay | Surface plasmon resonance |
| PDB_ID | 1Q5W |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Structure of the La motif: a winged helix domain mediates RNA binding via a conserved aromatic patch. |
| Release_Year | 2004 |
| PMID | 14976553 |
| DOI | 10.1038/sj.emboj.7600115 |