PPIRE02523
Target Protein Information
| Protein_Name | Placenta growth factor |
|---|---|
| Protein_Sequence | MPVMRLFPCFLQLLAGLALPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRHSPGRQSPDMPGDFRADAPSFLPPRRSLPMLFRMEWGCALTGSQSAVWPSSPVPEEIPRMHPGRNGKKQQRKPLREKMKPERCGDAVPRR |
| Organism_Source | Homo sapiens |
| Functional_Classification | other |
| Cellular_Localization | Extracellular |
| Gene_Names | PGF |
| UniProt_ID | P49763 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | 5 |
|---|---|
| Peptide_Sequence | YDICKYIRLPHCKAV |
| Peptide_Length | 15 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CC(=O)O)NC(=O)[C@@H](N)Cc1ccc(O)cc1)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@H](C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CC(C)C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)N[C@H](C(=O)O)C(C)C)[C@@H](C)CC |
| Chemical_Modification | None |
| Cyclization_Method | C4<->C12;side chain cyclization;disulfide bond |
| Linear/Cyclic | Cyclic |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1822.22 |
|---|---|
| Aliphatic_Index | 104.00000 |
| Aromaticity | 0.13333 |
| Average_Rotatable_Bonds | 3.80000 |
| Charge_at_pH_7 | 1.96310 |
| Isoelectric_Point | 8.76972 |
|---|---|
| Hydrogen_Bond_Acceptors | 25 |
| Hydrogen_Bond_Donors | 26 |
| Topological_Polar_Surface_Area | 682.31000 |
| X_logP_energy | -2.77613 |
Interaction Information
| Affinity | IC50=100 uM |
|---|---|
| Affinity_Assay | ELISA |
| PDB_ID | None |
| Type | antagonist |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Evolution of potent and stable placental-growth-factor-1-targeting CovX-bodies from phage display peptide discovery. |
| Release_Year | 2011 |
| PMID | 21280651 |
| DOI | 10.1021/jm101226k |