PPIRE02588
Target Protein Information
| Protein_Name | Gastrin/cholecystokinin type B receptor |
|---|---|
| Protein_Sequence | MELLKLNRSVQGPGPGSGSSLCRPGVSLLNSSSAGNLSCDPPRIRGTGTRELEMAIRITLYAVIFLMSVGGNVLIIVVLGLSRRLRTVTNAFLLSLAVSDLLLAVACMPFTLLPNLMGTFIFGTVICKAISYLMGVSVSVSTLNLVAIALERYSAICRPLQARVWQTRSHAARVILATWLLSGLLMVPYPVYTMVQPVGPRVLQCMHRWPSARVQQTWSVLLLLLLFFIPGVVIAVAYGLISRELYLGLHFDGENDSETQSRARNQGGLPGGAAPGPVHQNGGCRPVTSVAGEDSDGCCVQLPRSRLEMTTLTTPTPGPVPGPRPNQAKLLAKKRVVRMLLVIVLLFFLCWLPVYSVNTWRAFDGPGAQRALSGAPISFIHLLSYVSACVNPLVYCFMHRRFRQACLDTCARCCPRPPRARPQPLPDEDPPTPSIASLSRLSYTTISTLGPG |
| Organism_Source | Rattus norvegicus |
| Functional_Classification | receptor |
| Cellular_Localization | Plasma membrane |
| Gene_Names | Cckbr |
| UniProt_ID | P30553 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | 8 |
|---|---|
| Peptide_Sequence | WLDF |
| Peptide_Length | 4 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@@H](N)Cc1c[nH]c2ccccc12)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](Cc1ccccc1)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Other |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 579.65 |
|---|---|
| Aliphatic_Index | 97.50000 |
| Aromaticity | 0.50000 |
| Average_Rotatable_Bonds | 3.75000 |
| Charge_at_pH_7 | -1.00157 |
| Isoelectric_Point | 3.74999 |
|---|---|
| Hydrogen_Bond_Acceptors | 6 |
| Hydrogen_Bond_Donors | 7 |
| Topological_Polar_Surface_Area | 203.71000 |
| X_logP_energy | 1.34020 |
Interaction Information
| Affinity | IC50=0.5 uM |
|---|---|
| Affinity_Assay | Radioligand binding assay |
| PDB_ID | None |
| Type | Agonist |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Synthesis and biological activities of some pseudo-peptide analogues of tetragastrin: the importance of the peptide backbone. |
| Release_Year | 1985 |
| PMID | 2999406 |
| DOI | 10.1021/jm00150a020 |