PPIRE02761
Target Protein Information
| Protein_Name | Gag-Pro polyprotein |
|---|---|
| Protein_Sequence | MGQIHGLSPTPIPKAPRGLSTHHWLNFLQAAYRLQPRPSDFDFQQLRRFLKLALKTPIWLNPIDYSLLASLIPKGYPGRVVEIINILVKNQVSPSAPAAPVPTPICPTTTPPPPPPPSPEAHVPPPYVEPTTTQCFPILHPPGAPSAHRPWQMKDLQAIKQEVSSSALGSPQFMQTLRLAVQQFDPTAKDLQDLLQYLCSSLVVSLHHQQLNTLITEAETRGMTGYNPMAGPLRMQANNPAQQGLRREYQNLWLAAFSTLPGNTRDPSWAAILQGLEEPYCAFVERLNVALDNGLPEGTPKEPILRSLAYSNANKECQKILQARGHTNSPLGEMLRTCQAWTPKDKTKVLVVQPRRPPPTQPCFRCGKVGHWSRDCTQPRPPPGPCPLCQDPSHWKRDCPQLKPPQEEGEPLLLDLPSTSGTTEEKNLLKGGDLISPHPDQDISILPLIPLRQQQQPILGVRISVMGQTPQPTQALLDTGADLTVIPQTLVPGPVKLHDTLILGASGQTNTQFKLLQTPLHIFLPFRRSPVILSSCLLDTHNKWTIIGRDALQQCQGLLYLPDDPSPHQLLPIATPNTIGLEHLPPPPQVDQFPLNLSASRP |
| Organism_Source | Human T-cell leukemia virus 2 |
| Functional_Classification | Enzyme |
| Cellular_Localization | Cytoplasm |
| Gene_Names | gag-pro |
| UniProt_ID | P03353 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | U-85548e |
|---|---|
| Peptide_Sequence | VSQNXXIV |
| Peptide_Length | 8 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)CNC(=O)CNC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)C(C)C)C(=O)N[C@H](C(=O)O)C(C)C |
| Chemical_Modification | X5=1-hydroxy-2-amino-4-methylpentylene; X6=2,3-dimethylbutanoic acid |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 772.86 |
|---|---|
| Aliphatic_Index | 121.25000 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 3.12500 |
| Charge_at_pH_7 | -0.00202 |
| Isoelectric_Point | 6.10000 |
|---|---|
| Hydrogen_Bond_Acceptors | 12 |
| Hydrogen_Bond_Donors | 12 |
| Topological_Polar_Surface_Area | 373.43000 |
| X_logP_energy | -5.45400 |
Interaction Information
| Affinity | Ki=1 nM |
|---|---|
| Affinity_Assay | Enzyme Inhibition Kinetics |
| PDB_ID | 8HVP |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Structure at 2.5-A resolution of chemically synthesized human immunodeficiency virus type 1 protease complexed with a hydroxyethylene-based inhibitor. |
| Release_Year | 1991 |
| PMID | 1993177 |
| DOI | 10.1021/bi00220a023 |