PPIRE02984
Target Protein Information
| Protein_Name | GRB2-related adapter protein 2 |
|---|---|
| Protein_Sequence | MEAVAKFDFTASGEDELSFHTGDVLKILSNQEEWFKAELGSQEGYVPKNFIDIQFPKWFHEGLSRHQAENLLMGKEVGFFIIRASQSSPGDFSISVRHEDDVQHFKVMRDNKGNYFLWTEKFPSLNKLVDYYRTNSISRQKQIFLRDRTREDQGHRGNSLDRRSQGGPHLSGAVGEEIRPSMNRKLSDHPPTLPLQQHQHQPQPPQYAPAPQQLQQPPQQRYLQHHHFHQERRGGSLDINDGHCGTGLGSEMNAALMHRRHTDPVQLQAAGRVRWARALYDFEALEDDELGFHSGEVVEVLDSSNPSWWTGRLHNKLGLFPANYVAPMTR |
| Organism_Source | Homo sapiens |
| Functional_Classification | E3 ubiquitin ligase adaptors |
| Cellular_Localization | Cytoplasm |
| Gene_Names | GRAP2 |
| UniProt_ID | O75791 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | SLP-76 peptide |
|---|---|
| Peptide_Sequence | APSIDRSTKPA |
| Peptide_Length | 11 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CO)NC(=O)[C@@H]1CCCN1C(=O)[C@H](C)N)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CO)C(=O)N[C@H](C(=O)N[C@@H](CCCCN)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C)C(=O)O)[C@@H](C)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1142.28 |
|---|---|
| Aliphatic_Index | 53.63636 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 3.09091 |
| Charge_at_pH_7 | 0.99813 |
| Isoelectric_Point | 9.69502 |
|---|---|
| Hydrogen_Bond_Acceptors | 18 |
| Hydrogen_Bond_Donors | 18 |
| Topological_Polar_Surface_Area | 522.65000 |
| X_logP_energy | -7.42303 |
Interaction Information
| Affinity | KD=240 nM |
|---|---|
| Affinity_Assay | Bio-Layer Interferometry |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Molecular basis of phosphorylation-induced activation of the NADPH oxidase |
| Release_Year | 2003 |
| PMID | 12732142 |
| DOI | 10.1016/s0092-8674(03)00314-3 |