PPIRE03161
Target Protein Information
| Protein_Name | Protein Tat |
|---|---|
| Protein_Sequence | MADRRIPGTAEENLQKSSGGVPGQNTGGQEARPNYHCQLCFLRSLGIDYLDASLRKKNKQRLKAIQQGRQPQYLL |
| Organism_Source | Equine infectious anemia virus (strain Wyoming) |
| Functional_Classification | Viral envelope proteins |
| Cellular_Localization | Nucleus |
| Gene_Names | tat |
| UniProt_ID | P20920 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Fluorescein-rhodamine-labeled Tat peptide |
|---|---|
| Peptide_Sequence | AAARKKRRQRRRAAAC |
| Peptide_Length | 16 |
| Peptide_SMILES | C[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@@H](CS)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Other |
| C-terminal_Modification | other |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1869.23 |
|---|---|
| Aliphatic_Index | 37.50000 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 4.18750 |
| Charge_at_pH_7 | 7.93540 |
| Isoelectric_Point | 12.80742 |
|---|---|
| Hydrogen_Bond_Acceptors | 27 |
| Hydrogen_Bond_Donors | 39 |
| Topological_Polar_Surface_Area | 966.35000 |
| X_logP_energy | -13.17738 |
Interaction Information
| Affinity | KD=100 nM |
|---|---|
| Affinity_Assay | Laser induced liquid bead ion desorption |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Binding sites of the viral RNA element TAR and of TAR mutants for various peptide ligands, probed with LILBID: a new laser mass spectrometry. |
| Release_Year | 2008 |
| PMID | 18693035 |
| DOI | 10.1016/j.jasms.2008.07.001 |