PPIRE03424
Target Protein Information
| Protein_Name | Cathepsin B |
|---|---|
| Protein_Sequence | MWWSLIPLSCLLALTSAHDKPSSHPLSDDMINYINKQNTTWQAGRNFYNVDISYLKKLCGTVLGGPNLPERVGFSEDINLPESFDAREQWSNCPTIAQIRDQGSCGSCWAFGAVEAMSDRICIHTNGRVNVEVSAEDLLTCCGIQCGDGCNGGYPSGAWNFWTRKGLVSGGVYNSHIGCLPYTIPPCEHHVNGSRPPCTGEGDTPKCNKMCEAGYSTSYKEDKHYGYTSYSVSDSEKEIMAEIYKNGPVEGAFTVFSDFLTYKSGVYKHEAGDVMGGHAIRILGWGIENGVPYWLVANSWNVDWGDNGFFKILRGENHCGIESEIVAGIPRTQQYWGRF |
| Organism_Source | Rattus norvegicus |
| Functional_Classification | Enzyme |
| Cellular_Localization | Lysosome |
| Gene_Names | Ctsb |
| UniProt_ID | P00787 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | PB9 |
|---|---|
| Peptide_Sequence | LCGTVLGGPKLPERV |
| Peptide_Length | 15 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CS)NC(=O)[C@@H](N)CC(C)C)[C@@H](C)O)C(C)C)C(=O)NCC(=O)NCC(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@H](C(=O)O)C(C)C |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1538.87 |
|---|---|
| Aliphatic_Index | 116.66667 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 3.20000 |
| Charge_at_pH_7 | 0.93749 |
| Isoelectric_Point | 8.54513 |
|---|---|
| Hydrogen_Bond_Acceptors | 21 |
| Hydrogen_Bond_Donors | 21 |
| Topological_Polar_Surface_Area | 598.59000 |
| X_logP_energy | -4.88993 |
Interaction Information
| Affinity | Ki=11.6 uM |
|---|---|
| Affinity_Assay | Enzyme Inhibition Kinetics |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Inhibition of cathepsin B by its propeptide: use of overlapping peptides to identify a critical segment. |
| Release_Year | 1996 |
| PMID | 8774851 |
| DOI | 10.1016/0014-5793(96)00822-8 |