PPIRE03546
Target Protein Information
| Protein_Name | H-2 class II histocompatibility antigen, A-Q beta chain |
|---|---|
| Protein_Sequence | MALQIPSLLLSAAVVVLMVLSSPRTEGGNSERHFVAQLKGECYFTNGTQRIRSVNRYIYNREEWVRFDSDVGEYRAVTELGRPDAEYWNSQPEILERTRAEVDTVCRHNYEGVETHTSLRRLEQPNVAISLSRTEALNHHNTLVCSVTDFYPAKIKVRWFRNGQEETVGVSSTQLIRNGDWTFQVLVMLEMTPHQGEVYTCHVEHPSLKSPITVEWRAQSESARSKMLSGIGGCVLGVIFLGLGLFIRHRSQKGPRGPPPAGLLQ |
| Organism_Source | Mus musculus |
| Functional_Classification | Immune-related protein |
| Cellular_Localization | Plasma membrane |
| Gene_Names | H2-Ab1 |
| UniProt_ID | P06342 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | MBP 142-167 |
|---|---|
| Peptide_Sequence | KGVDAQGTLSKIFKLGGRDSRSGS |
| Peptide_Length | 24 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](C)NC(=O)[C@H](CC(=O)O)NC(=O)[C@@H](NC(=O)CNC(=O)[C@@H](N)CCCCN)C(C)C)[C@@H](C)O)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)NCC(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CO)C(=O)O |
| Chemical_Modification | |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2464.76 |
|---|---|
| Aliphatic_Index | 65.00000 |
| Aromaticity | 0.04167 |
| Average_Rotatable_Bonds | 3.66667 |
| Charge_at_pH_7 | 2.99799 |
| Isoelectric_Point | 11.05847 |
|---|---|
| Hydrogen_Bond_Acceptors | 38 |
| Hydrogen_Bond_Donors | 42 |
| Topological_Polar_Surface_Area | 1153.32000 |
| X_logP_energy | -16.75896 |
Interaction Information
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Quantitative Analysis of Peptides from Myelin Basic Protein Binding to the MHC Class II Protein, I-Au, Which Confers Susceptibility to Experimental Allergic Encephalomyelitis |
| Release_Year | 1996 |
| PMID | |
| DOI | 10.1007/bf03401615 |