PPIRE03583
Target Protein Information
| Protein_Name | Syntaxin-1A |
|---|---|
| Protein_Sequence | MKDRTQELRTAKDSDDDDDVTVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLETSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQSKARRKKIMIIICCVILGIIIASTIGGIFG |
| Organism_Source | Mus musculus |
| Functional_Classification | E3 ubiquitin ligase adaptors |
| Cellular_Localization | Plasma membrane |
| Gene_Names | Stx1a |
| UniProt_ID | O35526 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | myr-synA233-245 |
|---|---|
| Peptide_Sequence | IEYNVEHAVDYVE |
| Peptide_Length | 13 |
| Peptide_SMILES | CC[C@H](C)[C@H](N)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@H](C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@@H](C)C(=O)N[C@H](C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@H](C(=O)N[C@@H](CCC(=O)O)C(=O)O)C(C)C)C(C)C)C(C)C |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Other |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1579.68 |
|---|---|
| Aliphatic_Index | 104.61538 |
| Aromaticity | 0.15385 |
| Average_Rotatable_Bonds | 3.76923 |
| Charge_at_pH_7 | -3.90704 |
| Isoelectric_Point | 3.77752 |
|---|---|
| Hydrogen_Bond_Acceptors | 22 |
| Hydrogen_Bond_Donors | 22 |
| Topological_Polar_Surface_Area | 673.95000 |
| X_logP_energy | -3.94320 |
Interaction Information
| Affinity | IC50=4 uM |
|---|---|
| Affinity_Assay | NMR chemical shift perturbation |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Engineered peptides corresponding to segments of the H3 domain of syntaxin inhibit insulin release both in intact and permeabilized mouse pancreatic beta cells. |
| Release_Year | 1998 |
| PMID | 9675090 |
| DOI | 10.1006/bbrc.1998.8923 |