PPIRE03584
Target Protein Information
| Protein_Name | Syntaxin-1A |
|---|---|
| Protein_Sequence | MKDRTQELRTAKDSDDDDDVTVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLETSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQSKARRKKIMIIICCVILGIIIASTIGGIFG |
| Organism_Source | Mus musculus |
| Functional_Classification | E3 ubiquitin ligase adaptors |
| Cellular_Localization | Plasma membrane |
| Gene_Names | Stx1a |
| UniProt_ID | O35526 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | myr-synB200-212 |
|---|---|
| Peptide_Sequence | SEIIKLENSIREL |
| Peptide_Length | 13 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CO)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@H](CCC(=O)O)NC(=O)[C@@H](N)CO)[C@@H](C)CC)[C@@H](C)CC)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CC(C)C)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Other |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1543.78 |
|---|---|
| Aliphatic_Index | 150.00000 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 4.30769 |
| Charge_at_pH_7 | -0.99699 |
| Isoelectric_Point | 4.47943 |
|---|---|
| Hydrogen_Bond_Acceptors | 22 |
| Hydrogen_Bond_Donors | 24 |
| Topological_Polar_Surface_Area | 695.89000 |
| X_logP_energy | -5.70693 |
Interaction Information
| Affinity | IC50=2 uM |
|---|---|
| Affinity_Assay | NMR chemical shift perturbation |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Engineered peptides corresponding to segments of the H3 domain of syntaxin inhibit insulin release both in intact and permeabilized mouse pancreatic beta cells. |
| Release_Year | 1998 |
| PMID | 9675090 |
| DOI | 10.1006/bbrc.1998.8923 |