PPIRE03599
Target Protein Information
| Protein_Name | DNA-binding protein inhibitor ID-1 |
|---|---|
| Protein_Sequence | MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQQVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALTAEAACVPADDRILCR |
| Organism_Source | Homo sapiens |
| Functional_Classification | Transcriptional regulator |
| Cellular_Localization | Nucleus |
| Gene_Names | ID1 |
| UniProt_ID | P41134 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | 3C |
|---|---|
| Peptide_Sequence | YIEGLQALLRDQC |
| Peptide_Length | 13 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@@H](N)Cc1ccc(O)cc1)C(=O)N[C@@H](CCC(=O)O)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CS)C(=O)O |
| Chemical_Modification | |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1521.75 |
|---|---|
| Aliphatic_Index | 127.69231 |
| Aromaticity | 0.07692 |
| Average_Rotatable_Bonds | 3.92308 |
| Charge_at_pH_7 | -1.06262 |
| Isoelectric_Point | 4.18437 |
|---|---|
| Hydrogen_Bond_Acceptors | 21 |
| Hydrogen_Bond_Donors | 23 |
| Topological_Polar_Surface_Area | 655.43000 |
| X_logP_energy | -4.93653 |
Interaction Information
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Affinity of synthetic peptide fragments of MyoD for Id1 protein and their biological effects in several cancer cells. |
| Release_Year | 2010 |
| PMID | 20235117 |
| DOI | 10.1002/psc.1216 |