PPIRE03644
Target Protein Information
| Protein_Name | Major prion protein |
|---|---|
| Protein_Sequence | MANLGYWLLALFVTMWTDVGLCKKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGTWGQPHGGGWGQPHGGSWGQPHGGSWGQPHGGGWGQGGGTHNQWNKPSKPKTNLKHVAGAAAAGAVVGGLGGYMLGSAMSRPMIHFGNDWEDRYYRENMYRYPNQVYYRPVDQYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVVEQMCVTQYQKESQAYYDGRRSSSTVLFSSPPVILLISFLIFLIVG |
| Organism_Source | Mus musculus |
| Functional_Classification | other |
| Cellular_Localization | Plasma membrane |
| Gene_Names | Prnp |
| UniProt_ID | P04925 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Octapeptide repeat(OR) |
|---|---|
| Peptide_Sequence | PHGGSWGQ |
| Peptide_Length | 8 |
| Peptide_SMILES | NC(=O)CC[C@H](NC(=O)CNC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](CO)NC(=O)CNC(=O)CNC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@@H]1CCCN1)C(=O)O |
| Chemical_Modification | |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 824.85 |
|---|---|
| Aliphatic_Index | 0.00000 |
| Aromaticity | 0.12500 |
| Average_Rotatable_Bonds | 2.87500 |
| Charge_at_pH_7 | 0.08889 |
| Isoelectric_Point | 7.55032 |
|---|---|
| Hydrogen_Bond_Acceptors | 12 |
| Hydrogen_Bond_Donors | 13 |
| Topological_Polar_Surface_Area | 360.82000 |
| X_logP_energy | -4.94160 |
Interaction Information
| Affinity | KD=20 nM |
|---|---|
| Affinity_Assay | Surface plasmon resonance |
| PDB_ID | 4J8R |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | The crystal structure of an octapeptide repeat of the prion protein in complex with a Fab fragment of the POM2 antibody. |
| Release_Year | 2013 |
| PMID | 23629842 |
| DOI | 10.1002/pro.2270 |