PPIRE03657
Target Protein Information
| Protein_Name | Vacuolar protein sorting-associated protein 4A |
|---|---|
| Protein_Sequence | MTTSTLQKAIDLVTKATEEDKAKNYEEALRLYQHAVEYFLHAIKYEAHSDKAKESIRAKCVQYLDRAEKLKDYLRSKEKHGKKPVKENQSEGKGSDSDSEGDNPEKKKLQEQLMGAVVMEKPNIRWNDVAGLEGAKEALKEAVILPIKFPHLFTGKRTPWRGILLFGPPGTGKSYLAKAVATEANNSTFFSVSSSDLMSKWLGESEKLVKNLFELARQHKPSIIFIDEVDSLCGSRNENESEAARRIKTEFLVQMQGVGNNNDGTLVLGATNIPWVLDSAIRRRFEKRIYIPLPEEAARAQMFRLHLGSTPHNLTDANIHELARKTEGYSGADISIIVRDSLMQPVRKVQSATHFKKVCGPSRTNPSMMIDDLLTPCSPGDPGAMEMTWMDVPGDKLLEPVVCMSDMLRSLATTRPTVNADDLLKVKKFSEDFGQES |
| Organism_Source | Homo sapiens |
| Functional_Classification | other |
| Cellular_Localization | Cytoplasm |
| Gene_Names | VPS4A |
| UniProt_ID | Q9UN37 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | None |
|---|---|
| Peptide_Sequence | SHRPPPPGHRV |
| Peptide_Length | 11 |
| Peptide_SMILES | CC(C)[C@H](NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)CNC(=O)[C@@H]1CCCN1C(=O)[C@@H]1CCCN1C(=O)[C@@H]1CCCN1C(=O)[C@@H]1CCCN1C(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@@H](N)CO)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1236.40 |
|---|---|
| Aliphatic_Index | 26.36364 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 2.81818 |
| Charge_at_pH_7 | 2.17980 |
| Isoelectric_Point | 12.50011 |
|---|---|
| Hydrogen_Bond_Acceptors | 17 |
| Hydrogen_Bond_Donors | 17 |
| Topological_Polar_Surface_Area | 520.55000 |
| X_logP_energy | -5.99106 |
Interaction Information
| Affinity | KD=4.6 uM |
|---|---|
| Affinity_Assay | Surface plasmon resonance |
| PDB_ID | 2JQ9 |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Development of QSAR-Improved Statistical Potential for the Structure-Based Analysis of Protein?Peptide Binding Affinities. |
| Release_Year | 2013 |
| PMID | 27480231 |
| DOI | 10.1002/minf.201300064 |