PPIRE03699
Target Protein Information
| Protein_Name | 14-3-3 protein sigma |
|---|---|
| Protein_Sequence | MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS |
| Organism_Source | Homo sapiens |
| Functional_Classification | E3 ubiquitin ligase adaptors |
| Cellular_Localization | Cytoplasm |
| Gene_Names | SFN |
| UniProt_ID | P31947 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | CRaf |
|---|---|
| Peptide_Sequence | QHRYXTPHAFTFNTSSPCSEGSLSQRQRSTXTPNVH |
| Peptide_Length | 36 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](CO)NC(=O)CNC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CO)NC(=O)[C@H](CS)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](C)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](NC(=O)CNC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@@H](N)CCC(N)=O)[C@@H](C)O)[C@@H](C)O)[C@@H](C)O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CO)C(=O)N[C@H](C(=O)NCC(=O)N[C@H](C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(N)=O)C(=O)N[C@H](C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)O)C(C)C)[C@@H](C)O)[C@@H](C)O |
| Chemical_Modification | X5=phosphoserine;X31=phosphoserine |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 3974.26 |
|---|---|
| Aliphatic_Index | 21.66667 |
| Aromaticity | 0.08333 |
| Average_Rotatable_Bonds | 3.41667 |
| Charge_at_pH_7 | 2.20965 |
| Isoelectric_Point | 9.50246 |
|---|---|
| Hydrogen_Bond_Acceptors | 62 |
| Hydrogen_Bond_Donors | 65 |
| Topological_Polar_Surface_Area | 1822.70000 |
| X_logP_energy | -29.17829 |
Interaction Information
| Affinity | KD=1.5 uM |
|---|---|
| Affinity_Assay | Bio-Layer Interferometry |
| PDB_ID | 4FJ3 |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Targeting the Surface of the Protein 14-3-3 by Ultrasmall (1.5?nm)Gold Nanoparticles Carrying the Specific Peptide CRaf. |
| Release_Year | 2020 |
| PMID | 33275809 |
| DOI | 10.1002/cbic.202000761 |