PPIRE04030
Target Protein Information
| Protein_Name | Macrophage metalloelastase |
|---|---|
| Protein_Sequence | MSCTLLKGVCTMKFLMMIVFLQVSACGAAPMNDSEFAEWYLSRFYDYGKDRIPMTKTKTNRNFLKEKLQEMQQFFGLEATGQLDNSTLAIMHIPRCGVPDVQHLRAVPQRSRWMKRYLTYRIYNYTPDMKREDVDYIFQKAFQVWSDVTPLRFRKLHKDEADIMILFAFGAHGDFNYFDGKGGTLAHAFYPGPGIQGDAHFDEAETWTKSFQGTNLFLVAVHELGHSLGLQHSNNPKSIMYPTYRYLNPSTFRLSADDIRNIQSLYGAPVKPPSLTKPSSPPSTFCHQSLSFDAVTTVGEKIFFFKDWFFWWKLPGSPATNITSISSIWPSIPSGIQAAYEIESRNQLFLFKDEKYWLINNLVPEPHYPRSIYSLGFSASVKKVDAAVFDPLRQKVYFFVDKHYWRYDVRQELMDPAYPKLISTHFPGIKPKIDAVLYFKRHYYIFQGAYQLEYDPLFRRVTKTLKSTSWFGC |
| Organism_Source | Mus musculus |
| Functional_Classification | metalloproteases |
| Cellular_Localization | Plasma membrane |
| Gene_Names | Mmp12 |
| UniProt_ID | P34960 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Thiorphan |
|---|---|
| Peptide_Sequence | XG |
| Peptide_Length | 2 |
| Peptide_SMILES | NCC(=O)NCC(=O)O |
| Chemical_Modification | X1=3-mercapto-2-benzylpropanoyl |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | 3-Mercapto-2-Benzylpropanoyl |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 132.12 |
|---|---|
| Aliphatic_Index | 0.00000 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 1.50000 |
| Charge_at_pH_7 | -0.00202 |
| Isoelectric_Point | 6.10000 |
|---|---|
| Hydrogen_Bond_Acceptors | 3 |
| Hydrogen_Bond_Donors | 3 |
| Topological_Polar_Surface_Area | 92.42000 |
| X_logP_energy | -1.85410 |
Interaction Information
| Affinity | KD=4.7 nM |
|---|---|
| Affinity_Assay | Enzyme Inhibition Kinetics |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Rational design of enkephalinase inhibitors: substrate specificity of enkephalinase studied from inhibitory potency of various dipeptides. |
| Release_Year | 1980 |
| PMID | 7004444 |
| DOI | 10.1016/0006-291x(80)91371-6 |