PPIRE04196
Target Protein Information
| Protein_Name | Chymotrypsin-C |
|---|---|
| Protein_Sequence | MLGITVFTTFLAYASSCGAPIFQPNLSARVVGGEDAIPHSWPWQISLQYLRDNTWRHTCGGTLITPNHVLTAAHCISNTLTYRVALGKNNLEVEDEAGSLYVGVDTIFVHEKWNSFLVRNDIALIKLAETVELSDTIQVACLPEEGSLLPQDYPCFVTGWGRLYTNGPIAAELQQGLQPVVDYATCSQRDWWGTTVKETMVCAGGDGVISACNGDSGGPLNCQAENGNWDVRGIVSFGSGLSCNTFKKPTVFTRVSAYIDWINQKLQL |
| Organism_Source | Bos taurus |
| Functional_Classification | serine proteases |
| Cellular_Localization | Extracellular |
| Gene_Names | CTRC |
| UniProt_ID | Q7M3E1 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Pep3 |
|---|---|
| Peptide_Sequence | GAW |
| Peptide_Length | 3 |
| Peptide_SMILES | C[C@H](NC(=O)CN)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 332.36 |
|---|---|
| Aliphatic_Index | 33.33333 |
| Aromaticity | 0.33333 |
| Average_Rotatable_Bonds | 2.33333 |
| Charge_at_pH_7 | -0.00202 |
| Isoelectric_Point | 6.10000 |
|---|---|
| Hydrogen_Bond_Acceptors | 4 |
| Hydrogen_Bond_Donors | 5 |
| Topological_Polar_Surface_Area | 137.31000 |
| X_logP_energy | -0.25680 |
Interaction Information
| Affinity | Ki=4.7 uM |
|---|---|
| Affinity_Assay | Enzyme Inhibition Kinetics |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Detection of native peptides as potent inhibitors of enzymes. Crystal structure of the complex formed between treated bovine alpha-chymotrypsin and an autocatalytically produced fragment, IIe-Val-Asn-Gly-Glu-Glu-Ala-Val-Pro-Gly-Ser-Trp-Pro-Trp, at 2.2 angstroms resolution. |
| Release_Year | 2005 |
| PMID | 15654893 |
| DOI | 10.1111/j.1742-4658.2004.04499.x |