PPIRE04284
Target Protein Information
| Protein_Name | Tyr recombinase domain-containing protein |
|---|---|
| Protein_Sequence | MAKFIKASSIPSYLSGVVFCLCPLYPEITHIRHDDHIRLVLRGLLRQHGSNINCKQPISFTDLDKLFTTYPHKSYDNQLFLTMLTVGFFGLLRLGELADSNDVRLINRCKTIQHKSLYFTASSAGFILPASKTDRFFAGNKVIVKSNHHHNDPVQAVRLYVNQHDQPFPNLPWLWLTSQGIPPTRSWFLNCFHLHFDTRYRGHSMRAGGATLLAQHGVPFHVIQAIGRWSSETFLIYIRTHPSLLIPAT |
| Organism_Source | Agaricus bisporus var. burnettii |
| Functional_Classification | polyphenol oxidases |
| Cellular_Localization | Cytoplasm |
| Gene_Names | |
| UniProt_ID | A0A8H7C4C8 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | IW3 |
|---|---|
| Peptide_Sequence | IRW |
| Peptide_Length | 3 |
| Peptide_SMILES | CC[C@H](C)[C@H](N)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)O |
| Chemical_Modification | |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 473.58 |
|---|---|
| Aliphatic_Index | 130.00000 |
| Aromaticity | 0.33333 |
| Average_Rotatable_Bonds | 4.33333 |
| Charge_at_pH_7 | 0.99798 |
| Isoelectric_Point | 10.55000 |
|---|---|
| Hydrogen_Bond_Acceptors | 5 |
| Hydrogen_Bond_Donors | 8 |
| Topological_Polar_Surface_Area | 199.21000 |
| X_logP_energy | 0.40127 |
Interaction Information
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Food-Derived Bioactive Peptides with Antioxidative Capacity, Xanthine Oxidase and Tyrosinase Inhibitory Activity |
| Release_Year | 2021 |
| PMID | |
| DOI | 10.3390/pr9050747 |