PPIRE04366
Target Protein Information
| Protein_Name | Kallikrein-5 |
|---|---|
| Protein_Sequence | MATARPPWMWVLCALITALLLGVTEHVLANNDVSCDHPSNTVPSGSNQDLGAGAGEDARSDDSSSRIINGSDCDMHTQPWQAALLLRPNQLYCGAVLVHPQWLLTAAHCRKKVFRVRLGHYSLSPVYESGQQMFQGVKSIPHPGYSHPGHSNDLMLIKLNRRIRPTKDVRPINVSSHCPSAGTKCLVSGWGTTKSPQVHFPKVLQCLNISVLSQKRCEDAYPRQIDDTMFCAGDKAGRDSCQGDSGGPVVCNGSLQGLVSWGDYPCARPNRPGVYTNLCKFTKWIQETIQANS |
| Organism_Source | Homo sapiens |
| Functional_Classification | serine peptidases |
| Cellular_Localization | Extracellular |
| Gene_Names | KLK5 |
| UniProt_ID | Q9Y337 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | leupeptin |
|---|---|
| Peptide_Sequence | LLR |
| Peptide_Length | 3 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@@H](N)CC(C)C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Acetyl |
| C-terminal_Modification | aldehyde |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 400.52 |
|---|---|
| Aliphatic_Index | 260.00000 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 4.33333 |
| Charge_at_pH_7 | 0.99798 |
| Isoelectric_Point | 10.55000 |
|---|---|
| Hydrogen_Bond_Acceptors | 5 |
| Hydrogen_Bond_Donors | 7 |
| Topological_Polar_Surface_Area | 183.42000 |
| X_logP_energy | -0.27663 |
Interaction Information
| Affinity | Ki=1.7 uM |
|---|---|
| Affinity_Assay | Enzyme Inhibition Kinetics |
| PDB_ID | 2PSX |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Structural basis of the zinc inhibition of human tissue kallikrein 5. |
| Release_Year | 2007 |
| PMID | 17881000 |
| DOI | 10.1016/j.jmb.2007.08.042 |