PPIRE04417
Target Protein Information
| Protein_Name | fMet-Leu-Phe receptor |
|---|---|
| Protein_Sequence | MNTNMSAVNFMNMSGSTRSVSAGYIVLDIFSYLIFALTFVLGVLGNGLVIWVAGFRMKRTVTTISYLNLAIADFCFTSTLPFYIVSLVMGGIWPFGWFMCKFIYTVIDINLFGSVFLIALIALDRCVCVLHPVWAQNHRTVTLAKKVIIVPWICAFLLTLPVIIRVTTVPNRLGPGKTACALDFSPWTKDRAEKDKVAITMYTVRGIIRFILGFSTPMSIVAICYGLIATKIHRQGLIKSSRPLRVLSFVVAAFFLCWCPFQVVGLIRTIQIREHLRNIPQSTLTAMKITSSLAFFNSCLNPILYVFMGQDFRQRLIHSLPASLERALSEDSAQTSDTGTNLGANSIPENPANAM |
| Organism_Source | Rattus norvegicus |
| Functional_Classification | G protein-coupled receptor |
| Cellular_Localization | Plasma membrane |
| Gene_Names | Fpr1 |
| UniProt_ID | D4A7Q2 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | f-met-leu-phe |
|---|---|
| Peptide_Sequence | MLF |
| Peptide_Length | 3 |
| Peptide_SMILES | CSCC[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](Cc1ccccc1)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | N-Formyl |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 409.54 |
|---|---|
| Aliphatic_Index | 130.00000 |
| Aromaticity | 0.33333 |
| Average_Rotatable_Bonds | 4.00000 |
| Charge_at_pH_7 | -0.00202 |
| Isoelectric_Point | 6.10000 |
|---|---|
| Hydrogen_Bond_Acceptors | 5 |
| Hydrogen_Bond_Donors | 4 |
| Topological_Polar_Surface_Area | 121.52000 |
| X_logP_energy | 1.40980 |
Interaction Information
| Affinity | KD=6 nM |
|---|---|
| Affinity_Assay | radioligand binding assay |
| PDB_ID | None |
| Type | Agonist |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Acute ethanol intoxication regulates f-met-leu-phe-induced chemotaxis and superoxide release by neutrophils and Kupffer cells through modulation of the formyl peptide receptor in the rat. |
| Release_Year | 1994 |
| PMID | 8107522 |
| DOI | 10.1016/0024-3205(94)90161-9 |