PPIRE04447
Target Protein Information
| Protein_Name | Cathepsin B |
|---|---|
| Protein_Sequence | MWWSLIPLSCLLALTSAHDKPSSHPLSDDMINYINKQNTTWQAGRNFYNVDISYLKKLCGTVLGGPNLPERVGFSEDINLPESFDAREQWSNCPTIAQIRDQGSCGSCWAFGAVEAMSDRICIHTNGRVNVEVSAEDLLTCCGIQCGDGCNGGYPSGAWNFWTRKGLVSGGVYNSHIGCLPYTIPPCEHHVNGSRPPCTGEGDTPKCNKMCEAGYSTSYKEDKHYGYTSYSVSDSEKEIMAEIYKNGPVEGAFTVFSDFLTYKSGVYKHEAGDVMGGHAIRILGWGIENGVPYWLVANSWNVDWGDNGFFKILRGENHCGIESEIVAGIPRTQQYWGRF |
| Organism_Source | Rattus norvegicus |
| Functional_Classification | cysteine proteases |
| Cellular_Localization | Lysosome |
| Gene_Names | Ctsb |
| UniProt_ID | P00787 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | ZPLLal |
|---|---|
| Peptide_Sequence | PLL |
| Peptide_Length | 3 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@@H]1CCCN1)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Benzyloxycarbonyl |
| C-terminal_Modification | aldehyde |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 341.45 |
|---|---|
| Aliphatic_Index | 260.00000 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 3.00000 |
| Charge_at_pH_7 | -0.00202 |
| Isoelectric_Point | 6.10000 |
|---|---|
| Hydrogen_Bond_Acceptors | 4 |
| Hydrogen_Bond_Donors | 4 |
| Topological_Polar_Surface_Area | 107.53000 |
| X_logP_energy | 0.88480 |
Interaction Information
| Affinity | IC50=84 nM |
|---|---|
| Affinity_Assay | Enzyme Inhibition Kinetics |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Inhibition of rat liver cathepsins B and L by the peptide aldehyde benzyloxycarbonyl-leucyl-leucyl-leucinal and its analogues. |
| Release_Year | 2009 |
| PMID | 18830882 |
| DOI | 10.1080/14756360802166921 |