PPIRE04598
Target Protein Information
| Protein_Name | D(2)dopamine receptor |
|---|---|
| Protein_Sequence | MDPLNLSWYDDDLERQNWSRPFNGSEGKADRPHYNYYAMLLTLLIFIIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMIAIVWVLSFTISCPLLFGLNNTDQNECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRKRRKRVNTKRSSRAFRANLKTPLKGNCTHPEDMKLCTVIMKSNGSFPVNRRRMDAARRAQELEMEMLSSTSPPERTRYSPIPPSHHQLTLPDPSHHGLHSNPDSPAKPEKNGHAKIVNPRIAKFFEIQTMPNGKTRTSLKTMSRRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSAVNPIIYTTFNIEFRKAFMKILHC |
| Organism_Source | Rattus norvegicus |
| Functional_Classification | G protein-coupled receptor |
| Cellular_Localization | Plasma membrane |
| Gene_Names | Drd2 |
| UniProt_ID | P61169 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | TRH |
|---|---|
| Peptide_Sequence | XHP |
| Peptide_Length | 3 |
| Peptide_SMILES | NCC(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N1CCC[C@H]1C(=O)O |
| Chemical_Modification | X1=pyroglutamate |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Pyroglutamate |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 309.32 |
|---|---|
| Aliphatic_Index | 0.00000 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 2.00000 |
| Charge_at_pH_7 | 0.08889 |
| Isoelectric_Point | 7.55032 |
|---|---|
| Hydrogen_Bond_Acceptors | 5 |
| Hydrogen_Bond_Donors | 4 |
| Topological_Polar_Surface_Area | 141.41000 |
| X_logP_energy | -1.52870 |
Interaction Information
| Affinity | IC50=54 uM |
|---|---|
| Affinity_Assay | radioligand binding assay |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Binding of opiates and endogenous opioid peptides to neuroleptic receptor sites in the corpus striatum. |
| Release_Year | 1978 |
| PMID | 205747 |
| DOI | 10.1016/0024-3205(78)90360-0 |