PPIRE04605
Target Protein Information
| Protein_Name | Proteasome subunit beta type-7 |
|---|---|
| Protein_Sequence | MAAVSVFQPPVGGFSFDNCRRNAVLEADFAKKGFKLPKARKTGTTIAGVVYKDGIVLGADTRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLTTGRLPRVVTANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPDMEEEEAKKLVSEAIAAGIFNDLGSGSNIDLCVISKSKLDFLRPFSVPNKKGTRLGRYRCEKGTTAVLTEKVTPLEIEVLEETVQTMDTS |
| Organism_Source | Mus musculus |
| Functional_Classification | protease |
| Cellular_Localization | Cytoplasm |
| Gene_Names | Psmb7 |
| UniProt_ID | P70195 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | II-7 |
|---|---|
| Peptide_Sequence | XLP |
| Peptide_Length | 3 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)CN)C(=O)N1CCC[C@H]1C(=O)O |
| Chemical_Modification | X1=2-naphthylalanine |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Cbz |
| C-terminal_Modification | boronic acid |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 285.34 |
|---|---|
| Aliphatic_Index | 130.00000 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 2.00000 |
| Charge_at_pH_7 | -0.00202 |
| Isoelectric_Point | 6.10000 |
|---|---|
| Hydrogen_Bond_Acceptors | 4 |
| Hydrogen_Bond_Donors | 3 |
| Topological_Polar_Surface_Area | 112.73000 |
| X_logP_energy | -0.44840 |
Interaction Information
| Affinity | IC50=1.66 uM |
|---|---|
| Affinity_Assay | Enzyme Inhibition Kinetics |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Synthesis and biological activity of peptide proline-boronic acids as proteasome inhibitors. |
| Release_Year | 2017 |
| PMID | 28634039 |
| DOI | 10.1016/j.bmc.2017.05.049 |