PPIRE04616
Target Protein Information
| Protein_Name | P2Y purinoceptor 12 |
|---|---|
| Protein_Sequence | MQAVDNLTSAPGNTSLCTRDYKITQVLFPLLYTVLFFVGLITNGLAMRIFFQIRSKSNFIIFLKNTVISDLLMILTFPFKILSDAKLGTGPLRTFVCQVTSVIFYFTMYISISFLGLITIDRYQKTTRPFKTSNPKNLLGAKILSVVIWAFMFLLSLPNMILTNRQPRDKNVKKCSFLKSEFGLVWHEIVNYICQVIFWINFLIVIVCYTLITKELYRSYVRTRGVGKVPRKKVNVKVFIIIAVFFICFVPFHFARIPYTLSQTRDVFDCTAENTLFYVKESTLWLTSLNACLDPFIYFFLCKSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM |
| Organism_Source | Homo sapiens |
| Functional_Classification | G protein-coupled receptor |
| Cellular_Localization | Plasma membrane |
| Gene_Names | P2RY12 |
| UniProt_ID | Q9H244 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Pt-B |
|---|---|
| Peptide_Sequence | XQW |
| Peptide_Length | 3 |
| Peptide_SMILES | NCC(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)O |
| Chemical_Modification | X1=pyroglutamate |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Pyroglutamate |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 389.41 |
|---|---|
| Aliphatic_Index | 0.00000 |
| Aromaticity | 0.33333 |
| Average_Rotatable_Bonds | 3.33333 |
| Charge_at_pH_7 | -0.00202 |
| Isoelectric_Point | 6.10000 |
|---|---|
| Hydrogen_Bond_Acceptors | 5 |
| Hydrogen_Bond_Donors | 6 |
| Topological_Polar_Surface_Area | 180.40000 |
| X_logP_energy | -1.01120 |
Interaction Information
| Affinity | IC50=203 uM |
|---|---|
| Affinity_Assay | platelet aggregation assay |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Antiplatelet Aggregation and Antithrombosis Efficiency of Peptides in the Snake Venom of Deinagkistrodon acutus: Isolation, Identification, and Evaluation. |
| Release_Year | 2015 |
| PMID | 26483843 |
| DOI | 10.1155/2015/412841 |