PPIRE05002
Target Protein Information
| Protein_Name | Peptide deformylase |
|---|---|
| Protein_Sequence | MSVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEEGIGLAATQVDIHQRIIVIDVSENRDERLVLINPELLEKSGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIQHEMDHLVGKLFMDYLSPLKQQRIRQKVEKLDRLKARA |
| Organism_Source | Escherichia coli (strain SE11) |
| Functional_Classification | metalloproteases |
| Cellular_Localization | Cytoplasm |
| Gene_Names | def |
| UniProt_ID | B6I200 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Met-Arg-Phe-Ala |
|---|---|
| Peptide_Sequence | MRFA |
| Peptide_Length | 4 |
| Peptide_SMILES | CSCC[C@H](N)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](C)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 523.65 |
|---|---|
| Aliphatic_Index | 25.00000 |
| Aromaticity | 0.25000 |
| Average_Rotatable_Bonds | 4.00000 |
| Charge_at_pH_7 | 0.99798 |
| Isoelectric_Point | 10.55000 |
|---|---|
| Hydrogen_Bond_Acceptors | 7 |
| Hydrogen_Bond_Donors | 8 |
| Topological_Polar_Surface_Area | 212.52000 |
| X_logP_energy | -0.86833 |
Interaction Information
| Affinity | Ki=400 uM |
|---|---|
| Affinity_Assay | Enzyme Inhibition Kinetics |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Design and synthesis of substrate analogue inhibitors of peptide deformylase. |
| Release_Year | 1999 |
| PMID | 10194346 |
| DOI | 10.1021/bi982622r |