PPIRE05295
Target Protein Information
| Protein_Name | Caspase-7 |
|---|---|
| Protein_Sequence | MADDQGCIEEQGVEDSANEDSVDAKPDRSSFVPSLFSKKKKNVTMRSIKTTRDRVPTYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQADSGPINDTDANPRYKIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFSQ |
| Organism_Source | Homo sapiens |
| Functional_Classification | cysteine proteases |
| Cellular_Localization | Cytoplasm |
| Gene_Names | CASP7 |
| UniProt_ID | P55210 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Ac-(3-OMe)Phe-betahLeu-V-D-CHO |
|---|---|
| Peptide_Sequence | XXVD |
| Peptide_Length | 4 |
| Peptide_SMILES | CC(C)[C@H](NC(=O)CNC(=O)CN)C(=O)N[C@@H](CC(=O)O)C(=O)O |
| Chemical_Modification | X1=3-methoxyphenylalanine; X2=beta-homoleucine |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Acetyl |
| C-terminal_Modification | aldehyde |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 346.34 |
|---|---|
| Aliphatic_Index | 72.50000 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 2.50000 |
| Charge_at_pH_7 | -1.00157 |
| Isoelectric_Point | 3.74999 |
|---|---|
| Hydrogen_Bond_Acceptors | 6 |
| Hydrogen_Bond_Donors | 6 |
| Topological_Polar_Surface_Area | 187.92000 |
| X_logP_energy | -2.75380 |
Interaction Information
| Affinity | IC50=86 uM |
|---|---|
| Affinity_Assay | Enzyme Inhibition Kinetics |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Selective detection of caspase-3 versus caspase-7 using activity-based probes with key unnatural amino acids. |
| Release_Year | 2013 |
| PMID | 23614665 |
| DOI | 10.1021/cb400209w |