PPIRE05481
Target Protein Information
| Protein_Name | Gamma-aminobutyric acid receptor-associated protein-like 1 |
|---|---|
| Protein_Sequence | MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK |
| Organism_Source | Homo sapiens |
| Functional_Classification | ubiquitin-like proteins |
| Cellular_Localization | Cytoplasm |
| Gene_Names | GABARAPL1 |
| UniProt_ID | Q9H0R8 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | PIK3C3 LIR |
|---|---|
| Peptide_Sequence | FELVK |
| Peptide_Length | 5 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](CCC(=O)O)NC(=O)[C@@H](N)Cc1ccccc1)C(=O)N[C@H](C(=O)N[C@@H](CCCCN)C(=O)O)C(C)C |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 634.77 |
|---|---|
| Aliphatic_Index | 136.00000 |
| Aromaticity | 0.20000 |
| Average_Rotatable_Bonds | 4.20000 |
| Charge_at_pH_7 | -0.00054 |
| Isoelectric_Point | 6.40880 |
|---|---|
| Hydrogen_Bond_Acceptors | 8 |
| Hydrogen_Bond_Donors | 8 |
| Topological_Polar_Surface_Area | 243.04000 |
| X_logP_energy | 0.27610 |
Interaction Information
| Affinity | KD=65 uM |
|---|---|
| Affinity_Assay | Bio-Layer Interferometry |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Members of the autophagy class III phosphatidylinositol 3-kinase complex I interact with GABARAP and GABARAPL1 via LIR motifs. |
| Release_Year | 2019 |
| PMID | 30767700 |
| DOI | 10.1080/15548627.2019.1581009 |