PPIRE05681
Target Protein Information
| Protein_Name | HLA class II histocompatibility antigen, DRB1 beta chain |
|---|---|
| Protein_Sequence | MVCLKLPGGSCMTALTVTLMVLSSPLALSGDTRPRFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFLNGQEEKAGMVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPTGFLS |
| Organism_Source | Homo sapiens |
| Functional_Classification | MHC class II |
| Cellular_Localization | Plasma membrane |
| Gene_Names | HLA-DRB1 |
| UniProt_ID | P01911 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | p18/73-86 |
|---|---|
| Peptide_Sequence | EELRSLYNTVATLY |
| Peptide_Length | 14 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](CO)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@@H](N)CCC(=O)O)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@@H](C)C(=O)N[C@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)O)[C@@H](C)O)C(C)C)[C@@H](C)O |
| Chemical_Modification | |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1671.87 |
|---|---|
| Aliphatic_Index | 111.42857 |
| Aromaticity | 0.14286 |
| Average_Rotatable_Bonds | 3.78571 |
| Charge_at_pH_7 | -1.00017 |
| Isoelectric_Point | 4.25815 |
|---|---|
| Hydrogen_Bond_Acceptors | 24 |
| Hydrogen_Bond_Donors | 26 |
| Topological_Polar_Surface_Area | 722.36000 |
| X_logP_energy | -5.96633 |
Interaction Information
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Role of polymorphic residues of human leucocyte antigen-DR molecules on the binding of human immunodeficiency virus peptides. |
| Release_Year | 1996 |
| PMID | 8778027 |
| DOI | 10.1046/j.1365-2567.1996.458547.x |