PPIRE05777
Target Protein Information
| Protein_Name | Beta sliding clamp |
|---|---|
| Protein_Sequence | MKFTIQKDRLVESVQDVLKAVSSRTTIPILTGIKIVASDDGVSFTGSDSDISIESFIPKEEGDKEIVTIEQPGSIVLQARFFSEIVKKLPMATVEIEVQNQYLTIIRSGKAEFNLNGLDADEYPHLPQIEEHHAIQIPTDLLKNLIRQTVFAVSTSETRPILTGVNWKVEQSELLCTATDSHRLALRKAKLDIPEDRSYNVVIPGKSLTELSKILDDNQELVDIVITETQVLFKAKNVLFFSRLLDGNYPDTTSLIPQDSKTEIIVNTKEFLQAIDRASLLAREGRNNVVKLSAKPAESIEISSNSPEIGKVVEAIVADQIEGEELNISFSPKYMLDALKVLEGAEIRVSFTGAMRPFLIRTPNDETIVQLILPVRTY |
| Organism_Source | Bacillus subtilis (strain 168) |
| Functional_Classification | processivity factors |
| Cellular_Localization | Cytoplasm |
| Gene_Names | dnaN |
| UniProt_ID | P05649 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | P7 |
|---|---|
| Peptide_Sequence | QXDLF |
| Peptide_Length | 5 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](CC(=O)O)NC(=O)CNC(=O)[C@@H](N)CCC(N)=O)C(=O)N[C@@H](Cc1ccccc1)C(=O)O |
| Chemical_Modification | X2=cyclohexylalanyl |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Acetyl |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 578.62 |
|---|---|
| Aliphatic_Index | 78.00000 |
| Aromaticity | 0.20000 |
| Average_Rotatable_Bonds | 3.60000 |
| Charge_at_pH_7 | -1.00157 |
| Isoelectric_Point | 3.74999 |
|---|---|
| Hydrogen_Bond_Acceptors | 8 |
| Hydrogen_Bond_Donors | 8 |
| Topological_Polar_Surface_Area | 260.11000 |
| X_logP_energy | -2.00210 |
Interaction Information
| Affinity | KD=6.85 uM |
|---|---|
| Affinity_Assay | Isothermal titration calorimetry |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Interaction of a Model Peptide on Gram Negative and Gram Positive Bacterial Sliding Clamps. |
| Release_Year | 2019 |
| PMID | 30912430 |
| DOI | 10.1021/acsinfecdis.9b00089 |